KEGG   Acinetobacter baumannii MDR-TJ: ABTJ_01177Help
Entry
ABTJ_01177        CDS       T02045                                 

Definition
(GenBank) malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
abr  Acinetobacter baumannii MDR-TJ
Pathway
abr00620  Pyruvate metabolism
abr01100  Metabolic pathways
abr01120  Microbial metabolism in diverse environments
abr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:abr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABTJ_01177
Enzymes [BR:abr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     ABTJ_01177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M Malate_DH
Motif
Other DBs
NCBI-ProteinID: AFI94795
UniProt: A0A454ATZ6
LinkDB All DBs
Position
complement(1227855..1230125)
Genome map
AA seq 756 aa AA seqDB search
MDDQSLKQAALNYHEYPNPGKISVTPSKQLVNQRDLALAYSPGVAAPCLEIERDPSAAAK
YTARGNLVAVVSNGTAVLGLGNIGPLASKPVMEGKGVLFKKFAGVDVFDIEIAENDPDKI
VDIVASLEPTFGGINLEDIKAPECFYIEKKLRERMKIPVFHDDQHGTSIIVGSALLNALQ
IVNKKIEEIKIVASGAGAAALSCLDLLCALGVNKENIIVADSRGLLTTSREGLDESKKRY
VQDIKATQLHEVMAGADMFLGLSAAGILTKDMVKQMAENPIIFALANPDPEILPEHAHEV
RPDVIMATGRSDYPNQVNNALCFPYIFRGALDVGATTINEDMKIACVHAIARMAHVEADA
ATYGEKSASFGRDYLIPRPLDQRLILEIAPAVAKAAMDSGVATRPIEDFSAYRQKLSEFV
YNSAFLMKPIFAQAKTDPKRIAYAEGEDERVLRAVQIAVDEDLAKPILVGRTAVIEANIK
KLGLRLQHGVNIEIVDQEQNPLYEEFWKDYYQTMQRKGITVEYAQREARRRSTLIAALLV
KFGKADGMLCGTYSSYNIHLDFVRNVIGLKEGMNNFFTLNALMLEDRNLFIADTYVNTNP
TAEQLAEMTILAAEEVRRFGITPRVALLSHSSFGSDQTDSSAQKMREVYRILSEQAPELE
VEGEMHGDAALDENIRHFAFPGSRFKGSANLLIMPNLDAANISFNLLKATSGNNVTIGPI
LLGAAKPVHILTPTATTRRLINMTALTVAEIQQQEK
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atggacgatcaatctttaaaacaggccgctttaaattaccacgaatatccaaatccaggg
aaaatcagcgtcacgccaagtaagcaacttgtcaaccaacgagatttggctctagcttat
tcaccaggggttgctgctccatgtttagagattgaacgtgatccttcagctgctgcaaaa
tatacagcgcgtggtaacttggttgctgttgtcagtaacggtactgcggttcttggttta
ggtaatattggtccattagcttctaaaccggtaatggaaggtaaaggcgttctgttcaaa
aagttcgctggtgtcgatgtatttgatattgaaattgctgaaaacgatccagataaaatc
gttgatattgttgcttcattagaaccaactttcggcggtattaaccttgaagatatcaaa
gcacctgaatgtttctatatcgagaagaaacttcgtgaacgcatgaaaattcctgtgttc
catgatgaccaacacggaacaagtattattgtaggttcagcattattaaatgctctacaa
atcgttaataagaaaattgaagaaatcaaaatcgttgcttcaggtgcaggtgctgctgcc
ctttcttgtttagatttactttgtgctttaggcgtaaataaagaaaatatcattgttgcc
gattctcgtggtcttcttacaacttcacgtgaaggcttggatgaatcgaaaaaacgttat
gtacaagacattaaagcgactcaattacatgaagtaatggctggcgcggatatgttctta
ggtctttcagctgctggtattctcaccaaagatatggtgaaacaaatggctgaaaatccg
attatctttgcattagcaaacccggatccagaaattctgcctgaacatgcacatgaagta
cgtccagatgtaatcatggcaactggtcgttcggactacccgaaccaagtaaacaatgct
ttatgtttcccttatatcttccgtggtgcacttgacgtaggtgctacaacaattaacgaa
gatatgaaaattgcatgtgtacatgcaattgcacgtatggctcacgtagaagctgacgca
gcgacttatggtgaaaaatctgcttcatttggtcgtgactacttaattccacgcccactt
gatcaacgtttgattttagaaatcgcgcctgctgttgctaaagctgcaatggactcaggt
gttgcaactcgtcctatcgaagatttctctgcatatcgtcaaaaactttctgagtttgtt
tataactcagcattcttgatgaaaccaatctttgctcaagcaaaaacagatcctaaacgt
attgcatacgctgaaggtgaagatgagcgcgtattacgtgctgttcaaattgcagttgat
gaagatttagctaaaccaatcttagttggtcgtacagcagtcattgaagcaaacatcaaa
aaattaggcttacgtttacaacacggcgtaaatatcgagattgtagatcaagaacaaaat
ccgttatacgaagagttctggaaagactactatcaaaccatgcaacgcaaaggcatcact
gttgaatatgctcaacgtgaagctcgccgtcgttcaacactcattgctgcacttctagtt
aagtttggcaaagcagatggtatgttatgtggtacttacagtagctataacattcacctt
gacttcgtacgcaatgtaattggtcttaaagaaggcatgaacaacttcttcacgcttaat
gcattaatgcttgaagatcgcaacttgtttattgctgatacttatgtaaacactaatcct
actgctgaacaacttgctgaaatgactattttagcggctgaagaagtacgtcgctttggt
attacaccacgtgtagcgctactttctcattcaagctttggtagtgaccagacagattca
agcgctcaaaaaatgcgtgaagtttatcgtattttatctgagcaagctccagagcttgaa
gttgaaggtgaaatgcatggtgatgcagcattagacgaaaatattcgtcattttgcattc
cctggttctcgtttcaaaggttcagcgaacttgttgattatgccgaacctagatgcagca
aatatttcgttcaacttgttaaaagcaacttctggtaacaacgtaacaattggtccaatt
ttgctaggtgctgctaaaccagttcatattttgactccgacagcgacgactcgccgtctt
atcaatatgactgctttaacagttgctgaaattcaacagcaagaaaagtaa

DBGET integrated database retrieval system