KEGG   Acinetobacter baumannii MDR-TJ: ABTJ_01971Help
Entry
ABTJ_01971        CDS       T02045                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
abr  Acinetobacter baumannii MDR-TJ
Pathway
abr00010  Glycolysis / Gluconeogenesis
abr00020  Citrate cycle (TCA cycle)
abr00620  Pyruvate metabolism
abr01100  Metabolic pathways
abr01110  Biosynthesis of secondary metabolites
abr01120  Microbial metabolism in diverse environments
abr01130  Biosynthesis of antibiotics
abr01200  Carbon metabolism
Module
abr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:abr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABTJ_01971
   00020 Citrate cycle (TCA cycle)
    ABTJ_01971
   00620 Pyruvate metabolism
    ABTJ_01971
Enzymes [BR:abr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ABTJ_01971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 RnfC_N
Motif
Other DBs
NCBI-ProteinID: AFI95574
UniProt: A0A454AW94
LinkDB All DBs
Position
complement(2042688..2044223)
Genome map
AA seq 511 aa AA seqDB search
MSEIKTLEIPKWGLSMEEGTIAQWLIKEGDSFNKGDEICEIETTKIVNVLEAPFAGTLRK
ILAKDGDTLPVGGLIAVCADNEVSDAEIEKFIASLGGSAAQAPAAPSEQSKAETSVPVAE
KAEQPLTTAASASAPAKVAKGDYAVPESLQGYQTSDDLFATPHALKLAEKHNVNLAKVTG
SGREGRISVQDIQKTVQAAGGQWPDVKQQTQTKVVKSTADDSQILATPVARRLAKQWGIN
LNDCRVSGTRGRVCKEDVEAVYYRNNPVSVSEQPLQCATQPQSTVTTVAMNGMRKAIASR
LQAAKRNAPHFRLVVDLNVEALQKLRKQINETVPQVKLSINDMLIKAAAAALIKVPEVNV
QFDEATQSILQFSQADISVAVAIPNGLITPIVKAANQKSLAQISDDMRDLATRAKTGKLQ
PDEFQGGSFSISNLGMLGIKQFDAIINPPQGAIMALGASESRAVVENGNVVVREIVTATL
SCDHRVIDGAVGAKFLASFKQFVENPALILV
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaattaaaacgctggagatcccaaaatggggattatccatggaagaaggcacg
atcgcccaatggttgattaaagagggtgatagctttaataagggcgatgaaatttgtgaa
attgaaaccacaaaaatcgtcaatgtgttagaagcgccttttgctggaacgctccgtaaa
attttagcgaaagatggtgatactttacctgttggtggacttattgccgtatgtgctgat
aatgaagtttctgatgcagaaattgaaaagtttatcgcatcactaggtggttcagcagct
caagcacctgcagcaccttcggaacaaagtaaagcggaaacatctgtacctgttgctgaa
aaagcagaacagccactgactacagcagctagtgcttcagctcctgcaaaggtagctaaa
ggggactacgctgtaccagagtcattacaaggctatcaaacatctgatgatttgtttgca
acaccacatgcgttaaagcttgcagaaaagcacaatgtaaacttggcaaaagtcacaggt
tctggtcgtgaaggacgtattagtgttcaagacatccagaagactgtacaggctgctggt
ggtcagtggcctgatgttaagcagcaaactcaaactaaagtggttaaatctacagctgat
gatagccaaattttagcgacgcctgtagcacgccgtttagcaaaacaatggggcattaac
ctaaatgactgccgtgtttcaggtactcgtggccgtgtctgtaaagaagatgttgaggca
gtttactatcgtaataacccagtgtcggtaagtgaacaacctttgcaatgtgcaactcaa
ccacaatcaaccgttacgacggtggcgatgaatgggatgcgtaaagcgattgcttcacgg
ttacaggctgcaaaacgtaacgcaccgcatttccgcttagtggtcgatctcaacgtagaa
gctttgcaaaaactacgtaagcagattaatgagactgttccacaagtgaaactttctatt
aatgacatgctaattaaggcagcggcggcggcactgattaaagtacctgaagtgaatgtt
caatttgatgaggcgactcaatcaattttacagttctctcaagcggatatttcggtggcc
gtagcgattccaaacggtttaattacacccattgtaaaagcagcaaatcaaaaatcgttg
gcacaaatttccgatgacatgcgtgatttggcaactcgtgctaagactggcaagttacaa
cctgacgagtttcagggtggtagctttagcatttcaaatttaggaatgttaggcattaaa
cagttcgatgccattattaacccaccgcaaggtgcaattatggcattaggtgcttcggaa
tctcgtgctgttgttgaaaatggcaatgtagtggttcgtgagattgtcacagcgacgttg
tcatgcgatcaccgagttattgatggcgcagttggggcgaaattcttggccagctttaag
cagtttgttgaaaaccctgctttaattttggtgtag

DBGET integrated database retrieval system