KEGG   Acholeplasma brassicae: BN85309680Help
Entry
BN85309680        CDS       T03095                                 

Gene name
trxB
Definition
(GenBank) Thioredoxin reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
abra  Acholeplasma brassicae
Brite
KEGG Orthology (KO) [BR:abra00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BN85309680 (trxB)
Enzymes [BR:abra01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BN85309680 (trxB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA HI0933_like FAD_oxidored FAD_binding_2 Thi4 NAD_binding_7 NAD_binding_8 FMO-like DAO AlaDh_PNT_C K_oxygenase CMV_1a_C Lycopene_cycl SAPIS-gp6
Motif
Other DBs
NCBI-ProteinID: CCV65989
UniProt: U4KT33
LinkDB All DBs
Position
1063818..1064783
Genome map
AA seq 321 aa AA seqDB search
MFNFTIDKTPKKDLSNDKTYDLIVLGGGPAGLNAALYAKRKNLDVIIVANEIGGQLNNTK
DVDNYLGFKAVDASRLIEAFQSHVNTFDVPTLTGVYVKEIQKSDNLFVISLSTGETLSSK
TIIYTLGGNPRKLGVKGEKEFQSRGVSYCVTCDGPFFKNKVVAVIGGGNSAVDAAIDLAQ
IAKQVVLIQRSQLRADQSSVLKLQSLPNVQIHLETDVLSFNGQDVLKSLSLYDKHHESTI
ELDVDGVFVEIGNIPNSDLASEFVLRNDQKEIITNELQETKTKGFYAAGDVTSMPHKQVI
IAASQGAIAALQAAIYINKGE
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgtttaattttaccattgacaagacaccgaaaaaagacctatcaaatgataaaacttat
gatttaattgtcttaggcggcggtccggccggcttaaatgctgccctatacgccaaaaga
aaaaatctggatgtgatcattgttgctaatgaaattggcggacaattaaataacacaaaa
gatgtcgacaattacttaggctttaaagccgttgatgcttctagactcattgaagcgttt
caatcgcacgtaaatacatttgatgtgcctactttgactggtgtttatgttaaagaaatc
caaaaatcggataacctatttgtcatttcactatcaactggtgaaaccctatcaagcaaa
accattatttataccttaggtggtaaccctagaaaactaggggttaaaggtgaaaaagaa
tttcaatcaagaggtgtcagttactgtgtaacctgtgatggtccgttttttaaaaacaaa
gtggtcgcggtcattggaggcggtaatagcgccgttgatgcagccattgaccttgcacaa
attgcaaaacaagtcgtcttaatacaacgaagtcaattaagagctgaccaatcgtctgtt
ttaaaactacagtcactacctaacgtccaaattcatcttgaaaccgatgttctatcattc
aatggacaagacgttttaaagtcactcagtctttatgataagcatcacgagtcaacgatt
gaactagacgttgatggcgtttttgttgaaattggaaacattccaaacagcgatttagcc
agtgaatttgtactgcgaaacgatcaaaaagaaattatcacaaacgaattacaagaaacc
aaaaccaaaggcttttatgccgctggtgatgtgacttcaatgccacataagcaagtcatt
attgccgctagccaaggcgctattgcagcccttcaagcagccatctacatcaataaagga
gaataa

DBGET integrated database retrieval system