KEGG   Azospirillum brasilense Sp245: AZOBR_180105Help
Entry
AZOBR_180105      CDS       T02152                                 

Gene name
ddlB
Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
abs  Azospirillum brasilense Sp245
Pathway
abs00473  D-Alanine metabolism
abs00550  Peptidoglycan biosynthesis
abs01100  Metabolic pathways
abs01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:abs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AZOBR_180105 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AZOBR_180105 (ddlB)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    AZOBR_180105 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:abs01011]
    AZOBR_180105 (ddlB)
Enzymes [BR:abs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AZOBR_180105 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:abs01011]
 Precursor biosynthesis
  Amino acid ligase
   AZOBR_180105 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 ATP-grasp B12-binding
Motif
Other DBs
NCBI-ProteinID: CCC99035
UniProt: G8AFN0
LinkDB All DBs
Position
2593913..2594863
Genome map
AA seq 316 aa AA seqDB search
MTTPHKKHVAVLMGGWSAEREVSLVSGAGVAKALEEEGYRVTAVDVQRDLEGLLRALTDP
RPDAVFNALHGRGGEDGTIQGVLEFLGIPYTHSGVRAAAVAMDKAMTKALLAPVGVRSPK
GLVLTKGELTGGAHPMPAPYIVKPVDEGSTVGVTLVREGQNSPVGDAWTFGERALVEEFI
PGRELTVGVMGGLDGECRPLTVTEIHFEAQVYDYTAKYSAGHAVHTVPAQIPEQVAEEAK
RLAVLAHRTLGCRGVSRSDFRWDDRKSGTDGLFFLEINNQPGMTPLSLVPEQAAAVGLSY
GALVAWMVENAACQLD
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccccccacaagaagcatgtcgccgtcctgatgggcggctggtcggcggagcgc
gaggtatcgctggtcagcggcgccggcgtcgccaaggcgctggaggaggaaggctaccgc
gtcaccgcggtggacgtgcagcgcgacctggaggggttgctgcgcgcgctgaccgacccg
cgccccgacgcggtgttcaacgccctgcacgggcgcggcggcgaggacgggaccatccag
ggcgtgctggaattcctcggcatcccctacacccattccggcgtgcgcgccgccgcggtc
gccatggacaaggcgatgaccaaggcgctgctcgccccggtcggcgtgcgctcgcccaag
ggcctcgtcctgaccaagggcgagctgaccggcggcgcccacccgatgcccgccccctac
atcgtcaagccggtggacgagggttcgacggtcggggtcacgctggtgcgcgaggggcag
aacagcccggtcggcgatgcctggaccttcggcgagcgcgccctggtcgaggagttcatc
ccgggccgcgagttgaccgtgggcgtcatgggcgggctggacggcgagtgccgccccctg
accgtgacggagatccacttcgaagcacaggtgtatgactacacggctaaatacagcgcg
ggccatgccgttcatactgtgcccgcgcagattcccgagcaagtcgcggaagaagccaag
aggttggcggtcctggcccaccggaccctcggatgccgcggcgtttcgcgcagcgacttc
cgctgggatgatcgtaaaagtgggaccgacggactctttttcctggaaatcaacaaccag
ccgggcatgacgccgctgtcgctggttcccgaacaggccgctgccgtggggctctcctac
ggggctctcgttgcttggatggtggagaacgccgcatgtcaactcgactga

DBGET integrated database retrieval system