KEGG   Azospirillum brasilense Sp245: AZOBR_40417Help
Entry
AZOBR_40417       CDS       T02152                                 

Definition
(GenBank) putative trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
abs  Azospirillum brasilense Sp245
Pathway
abs00500  Starch and sucrose metabolism
abs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AZOBR_40417
Enzymes [BR:abs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AZOBR_40417
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     AZOBR_40417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase MIIP
Motif
Other DBs
NCBI-ProteinID: CCC97248
UniProt: G8AJ36
LinkDB All DBs
Position
946069..947757
Genome map
AA seq 562 aa AA seqDB search
MIKDLWYKNAVIYNLSVGTFMDANGDGIGDFQGLQRRLDYLQGLGVTCLWLGPFQPSPMR
DHGYDVADYYNVDPRYGTLGDFVEFSHACKQRGIRVIIDLVVNHTSDQHPWFQAARKDPD
SPYRDWYVWSDKKPDDADQGVVFPGVQKTTWSWDKEARAYYFHRFYEFQPDLNTANPEVQ
AELLKVMGFWIELGVSGFRMDAVPFVIATKGPDVKKPKQQFDMLRTFREFVQWRCGDAVL
LAEANVLPTVDQEYFGDDGDRMQMVFNFQVNQNLFYALATADTRPLAKALDVTRVPRPST
NQWGLFLRNHDELDLGRLTEAQRKRVFDAFGPDKDMQLYDRGIRRRLAPMLRGDRRWLEL
AYSLLFTLPGTPVLRYGDEIGMGDDLSLPERECARTPMQWSDEPQGGFTKADDPVHPVIS
GGAYGYERINAAHQRRDPSALLNWTERIIRMRKECPEIGWGDFQVLPTGSNAVLAIRYDW
RNNSVLVVHNLDDRPHEIALAVDGTGESPRLVNLLAEDHNDPEEDGRHRLVLEPYGYRWY
RLGGLDYLLRRTEGPVGGAKRS
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaggatctctggtacaagaacgcggtcatctacaacctgtcggtcggcaccttc
atggacgccaacggcgacgggatcggcgatttccagggcttgcagcgccggctggactat
ttgcaggggctgggcgtgacctgcctctggctggggccgttccaaccgtcgccgatgcgt
gaccacggttacgacgtggccgactactacaatgtcgatccgcgctacggcacgctgggc
gacttcgtggagttcagccacgcctgcaagcagcgcggcatccgcgtcatcatcgacctc
gtggtcaatcacacctcggaccagcacccctggttccaggcggcgcgcaaggacccggac
tccccctaccgggactggtacgtgtggtcggacaaaaagccggacgacgccgaccagggc
gtcgtctttcccggcgtgcagaagacgacctggagctgggacaaggaggcccgcgcctat
tacttccaccgcttctacgagttccagccggacctgaacaccgccaacccggaggtgcag
gccgagctgctgaaggtgatgggcttctggatcgagctgggcgtgtcgggcttccgcatg
gacgccgtgcccttcgtcatcgcgaccaaggggccggacgtgaagaaacccaagcagcag
ttcgacatgctccgcactttccgggagttcgtgcagtggcggtgcggcgacgcggtgctg
ctggccgaggccaacgtgctgccgaccgtcgaccaggagtatttcggcgacgacggcgac
cgcatgcagatggtcttcaatttccaggtcaaccagaatctgttctacgcgctggcgacg
gcggacacgcggccgctggccaaggcgctggacgtcacccgggtgccgcgtcccagcacc
aaccagtggggcctgttcctgcgcaaccacgacgagctggacctcgggcgcctgaccgag
gcgcagcgcaagcgcgtcttcgacgcctttgggccggacaaggacatgcagctctacgac
cgcggcatccggcggcggctcgccccgatgctgcgcggcgaccggcgctggctggaactg
gcctacagcctgctgttcactctgcccggcacgccggtcctgcgctacggcgacgagatc
ggcatgggcgacgacctgtccctgccggagcgcgagtgcgcccgcacccccatgcagtgg
tcggacgagccgcagggtggcttcaccaaggcggacgaccccgtgcacccggtcatcagc
ggcggcgcctacggctatgagcggatcaacgccgcccaccagcgccgcgacccttcggcc
ctgctgaactggaccgagcgcatcatccgcatgcgcaaggaatgcccggaaatcggctgg
ggcgacttccaggtgctgcccaccggatcgaacgcggtgctggcgatccgctacgactgg
cgcaacaactccgtgctcgtcgtgcacaaccttgatgaccgtccccacgagatcgcgttg
gcggtcgatggcacgggagaatcgccgcggctggtcaatctgctggccgaggaccacaac
gaccccgaggaggacgggcggcatcgcctggtgctggagccgtacggctaccgctggtac
cggctgggcgggctggactatctgctgcgccggacggaggggccggtgggcggggcgaag
cggtcttga

DBGET integrated database retrieval system