KEGG   Azospirillum brasilense Sp245: AZOBR_p1130170Help
Entry
AZOBR_p1130170    CDS       T02152                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, F subunit,FAD/NAD(P)-binding
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
abs  Azospirillum brasilense Sp245
Brite
KEGG Orthology (KO) [BR:abs00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AZOBR_p1130170 (ahpF)
Enzymes [BR:abs01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AZOBR_p1130170 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_oxidored Thioredoxin_3 FAD_binding_2 AlaDh_PNT_C HI0933_like FAD_binding_3 DAO Glutaredoxin NAD_binding_7 NAD_binding_8 Thi4 FMO-like DUF3467 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: CCD00947
UniProt: G8ANX4
LinkDB All DBs
Position
AZOBR_p1:1367446..1369026
Genome map
AA seq 526 aa AA seqDB search
MLDSNVKGQLKAYFDKITQPIELAASLDDGAKSQDMQALLQDIASLSDKITFVRTDDDAR
KPSFAIKRTGTDVSVRFAGLPMGHEFNSLILALLQVGGHPSKESAEVIEQVKALEGEYSF
ETYFSLSCQNCPDVVQALNLMSVLNPRIKHVAIDGALFQQEVDSRKIMAVPSIFLNGEPF
GQGRMGLEQILAKIDTGASQRDAEKIKAKDAFDVLVIGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVSHTEGPKLATALEQHVKEYEVDVMNLQRAEKLIPAEGPGG
LIEIQLANGASLKSKTVILSTGARWRQMGVPGEDEYRNKGVAYCPHCDGPLFKGKRVSVI
GGGNSGVEAAIDLAGIVAEVTLIEFDSQLRADEVLQRKLRSLPNVRVITSGLTTEVHGDG
TKVTGLSYKNRNTGEVHRIDLEGIFVQIGLVPNTEWLKGSVALSPRGEIEVDARGQTSIP
GVFAAGDATTVPYKQIIIAMGEGSKAALSAFDYLIRMAPVEAVAAA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
gtgttggatagcaacgtcaaaggccagctcaaggcctatttcgacaagatcacgcagccc
atcgaactggccgcttccctggacgacggcgccaaatcgcaggacatgcaggctctgctg
caggacatcgcgtccctgtcggacaagatcaccttcgtccgcaccgacgacgacgcgcgc
aagccctccttcgcgatcaagcgcaccggcaccgacgtcagcgtccgtttcgccggcctg
ccgatgggccacgaattcaattccctcatcctcgccctgctgcaggtcggcggccacccc
tccaaggagtcggcggaggtcatcgagcaggtgaaggcgctggagggtgagtacagcttc
gagacctacttctcgctgtcctgccagaactgccctgacgtggtgcaggccctgaacctg
atgagcgttctgaacccgcggatcaagcatgtcgccatcgacggcgcgctgttccagcag
gaggtcgactcgcgcaagatcatggccgtcccgtccatcttcctgaacggcgagccgttc
ggccagggccgcatggggctggagcagatcctcgccaagatcgacaccggcgcctcgcag
cgcgacgcggagaagatcaaggccaaggacgccttcgacgtgctggtgatcggcggcggc
ccggccggcgccgcggcggcgatctacgccgcgcgcaagggcatccgcaccggcgtcgcg
gcggagcgcttcggcggtcaggtgctcgacaccatggccatcgagaacttcatctccgtc
tcccacaccgagggtccgaagctggccaccgcgctggagcagcacgtcaaggagtatgag
gtcgacgtgatgaacctgcagcgggcggaaaagctgatccccgccgagggtccgggcggc
ctgatcgagatccagctcgccaacggcgcctcgctgaagtccaagacggtgatcctgtcc
accggcgcccgctggcgccagatgggcgtccccggcgaggacgagtaccgcaacaagggc
gtggcctattgcccgcactgcgacggcccgctgttcaagggcaagcgcgtgtcggtcatc
ggcggcggcaactccggtgtggaagcggccatcgatctggccggcatcgtcgccgaggtg
acgctgatcgagttcgacagccagcttcgcgccgacgaggtgctccagcgcaagctgcgc
agcctgccgaacgtgcgcgtcatcacctcgggcctgacgaccgaggtgcatggcgacggc
accaaggtgaccggcctcagctacaagaaccgcaacaccggcgaggtgcaccgcatcgat
ctggaaggcatcttcgtgcagatcggcctcgtgcccaacaccgagtggctgaagggctcg
gtggcgctgagcccgcgcggcgagatcgaggtggacgcccgcggtcagacctccatcccc
ggcgtcttcgcggcgggcgacgcgacgacggtgccctacaagcagatcatcatcgccatg
ggcgagggctcgaaggccgccctgtcggccttcgactacctgatccgcatggcgccggtc
gaggccgtcgcggcggcgtaa

DBGET integrated database retrieval system