KEGG   Azospirillum brasilense Sp245: AZOBR_p1130199Help
Entry
AZOBR_p1130199    CDS       T02152                                 

Gene name
gatB
Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
abs  Azospirillum brasilense Sp245
Pathway
abs00970  Aminoacyl-tRNA biosynthesis
abs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abs00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AZOBR_p1130199 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:abs03029]
    AZOBR_p1130199 (gatB)
Enzymes [BR:abs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AZOBR_p1130199 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AZOBR_p1130199 (gatB)
Mitochondrial biogenesis [BR:abs03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AZOBR_p1130199 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: CCD00976
UniProt: G8AP03
LinkDB All DBs
Position
AZOBR_p1:1393063..1394514
Genome map
AA seq 483 aa AA seqDB search
MSYIQGETGDWEIVIGLEVHAQVISNAKLFSGAATAFGAEPNSQVSFVDAAFPGMLPVIN
ERCIEQAVRTGLGLKAQINLHSVFDRKNYFYADLPQGYQISQYLQPIVGKGEIVLDLPDG
SSRTVGVTRLHLEQDAGKSLHDQHPAKTYIDLNRSGVALMEIVSEPDMRTAEEAGAYVRK
LRSILRYLGTCDGNMEEGSMRCDVNVSVRKPGAPFGTRCEIKNVNSIRFVMQAIEYEARR
QIEIIEEGGKIDQETRLWDTTKFVTRSMRSKEEAHDYRYFPDPDLLPLELDADWVEDIKK
TLPELPDDKKARFISEYKLSPYDANVLVSEKARADFYEAVAKGRDPKLAANWVTGELFGY
LNKAGKEIEESPVSAENLGGLIDLIADNTISGRIAKEVFEAMFETGEKPADIVEKKGLRQ
VTDTGAIESSIDAVLAANADKVAEFRSGKDKLFGFFVGQVMKATQGKANPALVNEILMAK
LKG
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtacattcagggcgaaacgggcgattgggaaatcgtgatcgggctggaggtccac
gcccaggtcatctcgaacgccaagctgttctccggcgccgccaccgccttcggcgcggag
ccgaacagccaggtcagcttcgtcgacgccgcctttcccggcatgctgcccgtcatcaac
gagcgttgcatcgagcaggcggtgcgcaccggcctggggctgaaggcgcagatcaacctg
cactcggtgttcgatcgcaagaactacttctacgccgacctgccgcagggctatcagatc
agccagtatctgcagcccatcgtcggcaagggcgagatcgtgctggacctgccggacggc
tcctcccgcacggtcggcgtcacgcgtctgcacctggagcaggacgccggcaagtcgctg
cacgaccagcatcccgccaagacctacatcgacctgaaccggtcgggcgtggcgctgatg
gagatcgtgtcggagccggacatgcgcaccgcggaggaggccggcgcctatgtgcgcaag
ctgcgctccatcctgcgttacctcggcacctgcgacggcaacatggaggaaggctccatg
cgctgcgacgtcaacgtgtcggtgcgcaagccgggcgcgcccttcggcacgcgctgcgag
atcaagaacgtcaactcgattcgcttcgtcatgcaggcgatcgagtacgaggcgcgccgc
cagatcgagatcatcgaggagggcggcaagatcgaccaggagacgcgtctgtgggacacg
accaagttcgtgacccgctccatgcgctccaaggaagaggcgcacgactaccgctacttc
cccgatccggacctgctgccgctggagctggacgccgactgggtcgaggacatcaagaag
accctgccggaactgccggacgacaagaaggcccgcttcatcagcgagtacaagctgtcg
ccctatgacgccaacgtgctggtgtcggagaaggcccgcgccgacttctacgaggcggtc
gccaagggccgcgacccgaagctggccgccaactgggtcaccggcgagctgttcggctat
ctgaacaaggccggcaaggagatcgaggagagccccgtctcggcggagaacctcggtggc
ctgatcgacctgatcgccgacaacaccatctccggccgaatcgccaaggaggtgttcgag
gcgatgttcgaaaccggtgagaagcccgccgacatcgtcgagaaaaagggcctgcgccag
gtcaccgacaccggggccatcgagtcgtccatcgacgccgtgctggccgccaacgccgac
aaggtggcggagttccggtcgggcaaggacaagctgttcggcttcttcgtcggccaggtc
atgaaggcgacccagggcaaggccaacccggccctggtcaacgaaatcctcatggccaag
ctgaagggctga

DBGET integrated database retrieval system