Azospirillum baldaniorum Sp245: AZOBR_p1140020 Help Entry AZOBR_p1140020    CDS       T02152                                  Symbol xseB Name (GenBank) exonuclease VII small subunit   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism abs  Azospirillum baldaniorum Sp245 Pathway abs03430   Mismatch repair Brite KEGG Orthology (KO) [BR:abs00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     AZOBR_p1140020 (xseB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:abs03400]     AZOBR_p1140020 (xseB) Enzymes [BR:abs01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      AZOBR_p1140020 (xseB) DNA repair and recombination proteins [BR:abs03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      AZOBR_p1140020 (xseB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S ERM_helical TPR_7 Vps53_N TACC_C Motif Other DBs NCBI-ProteinID:  CCD01005 UniProt:  A0A9P1JWE4 LinkDB All DBs Position AZOBR_p1:1418733..1418987 Genome browser AA seq 84 aa AA seqDB search MADLANIPPDIAALSFEDALSELERIVRQLEDGRGKLDDAISSYERGTALKRHCEAKLRE AQAKIDRITVAADGTLGTEPARID NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggctgacctcgcaaacattcccccggacatcgccgctctcagcttcgaggacgcgctg tccgaactggaacgcatcgtgcgccagctcgaagacgggcgcggcaagctcgacgacgcg atctcctcctacgagcgcggcaccgcgctgaagcggcattgcgaggcgaagctgcgggag gcccaggccaagatcgaccgcatcaccgttgccgccgacggcaccctcggcactgaaccc gcccggatcgactga

DBGET integrated database retrieval system