KEGG   Azospirillum brasilense Sp245: AZOBR_p120093Help
Entry
AZOBR_p120093     CDS       T02152                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase, iron/manganese cofactor
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
abs  Azospirillum brasilense Sp245
Brite
Enzymes [BR:abs01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AZOBR_p120093 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CCC99775
UniProt: G8AQR4
LinkDB All DBs
Position
AZOBR_p1:220457..221062
Genome map
AA seq 201 aa AA seqDB search
MAFELPPLPYGYDALQPFMSSETLHLHHDKHHQTYVTNLNNLTKDSPLADASLEDVIKQS
YGDASKQGLFNNAGQVWNHTFYWQSMKKNGGGAIPGELEKRLIADFGSVDKFKEEFSNAA
ITQFGSGWAWLYIDGGKLKVTKTSNADTPLAQGHFPLLTADVWEHAYYVDYQNRRADFVK
AFLESLVNWEFVAERLSKAPA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcgaactgccgccgctcccgtatggctatgatgctctgcagccgttcatgtcg
tcggagacgctgcacctgcaccacgacaagcaccaccagacctacgtcaccaacctgaac
aacctgacgaaggacagcccgctggccgacgccagcctggaagacgtcatcaagcagagc
tacggcgatgcctccaagcagggcctcttcaacaacgccggtcaggtgtggaaccacacc
ttctattggcagagcatgaagaagaacggtggcggcgccatcccgggcgagcttgagaag
cgcctgatcgccgacttcggcagcgtcgacaagttcaaggaagagttctcgaacgccgcc
atcacgcagttcggctcgggctgggcgtggctgtacatcgacggcggcaagctgaaggtc
accaagacctccaacgccgacacgccgctggcccagggccacttcccgctgctgaccgcc
gacgtgtgggagcacgcctactacgtcgactaccagaaccgccgcgcggacttcgtgaag
gcgttcctggagagcctggtgaactgggagttcgtggccgagcgcctgtcgaaggccccg
gcctga

DBGET integrated database retrieval system