KEGG   Azospirillum brasilense Sp245: AZOBR_p210197Help
Entry
AZOBR_p210197     CDS       T02152                                 

Definition
(GenBank) uncharacterized ribulose bisphosphate carboxylase-like protein (modular protein)
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
abs  Azospirillum brasilense Sp245
Pathway
abs00630  Glyoxylate and dicarboxylate metabolism
abs00710  Carbon fixation in photosynthetic organisms
abs01100  Metabolic pathways
abs01120  Microbial metabolism in diverse environments
abs01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:abs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AZOBR_p210197
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AZOBR_p210197
Enzymes [BR:abs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     AZOBR_p210197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large Glyoxalase_4 RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: CCD01533
UniProt: G8AUC4
LinkDB All DBs
Position
AZOBR_p2:194023..195843
Genome map
AA seq 606 aa AA seqDB search
MSRFFGQIRQAGYVVDDIEAAMDYWSRTLGIGPWFYNERVPIRNYTYRGERYEVHNSVAL
ANSGPLQMELIQTRNDAPSMYRDFLKAGRTGLQHVAYWTENYDADLERLTGQGFKPVMSG
EVGEKGRFVYFDTEYHPRYGDRAVGGRRAEGQDVRPDPQRLPRLGRPRSGPALPRPQPAV
SPAMRSDRFEATYLIETPLDPAKVAEVMAGEQSCGTFTRVHGETDDLRARARAVVERVEE
LEPAASPSLPNTWLERQKRPGPWRRARVAISFPTGNVGANLPTLAATVAGNLFDLGEVTG
LRLDSVRLPAAYRKGFDTPRHGVAGTRRVTGVERGALVGSIIKPNLGLSAEETGELVGTL
CAAGLDFIKDDEICADPIHAPLAQRVPAVMDRVRRHQDRTGKHVMVAFNISDETDAMRRH
ADLVEREGGSCVMVSLNWCGFSAVQTLRRHSGLVLHGHRNGFGALSRHPSLGIGFDAYQT
LWRLAGVDHMHVHGLQGKFAQPDAEVIDGAKSCLAPLAEGCDDTVMPAFSSGQWAGTVPV
TWDAVGTDDLLFMSGGGIMAHPDGPAAGVTSIRQAWEAVREGVTLPDAAATRPELKRALE
FFGAGK
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgagccgattcttcggccagatccggcaggctggctacgtcgtcgacgacatcgaggcc
gccatggactactggagccgcaccctgggcatcggcccgtggttctacaacgagcgggtt
ccgatccggaactacacctaccgcggggagcggtacgaggttcacaactcggtggcgctc
gccaactccggcccgctccagatggagctgatccagacccgcaacgacgcgccgtcgatg
taccgcgacttcctgaaggcgggccgcaccggcctccagcacgtcgcctactggaccgag
aattacgacgccgacctggagcgactgaccggccagggcttcaagccggtgatgagcggc
gaagtcggcgagaagggccgcttcgtctatttcgacaccgaataccacccccggtacggt
gatcgagctgtcggaggtcgccgggccgaagggcaagatgttcgacctgatccgcaacgc
ctccctcgactgggacggccgcgatccggtccggcccttccccgacctcagccggctgtg
agtcccgccatgcgctccgaccgcttcgaggcgacctatctgatcgagaccccgctggat
cccgccaaggtggcggaggtcatggcgggggagcagtcctgcggcaccttcacccgcgtc
cacggcgagacggacgacctgcgcgcccgcgcccgcgccgtggtggagcgggtggaggag
ttggaacccgccgcctcccccagcctgccgaacacatggctggagcggcagaagcggccc
ggaccgtggcggcgcgcccgcgtcgccatcagcttccccaccggcaacgtcggcgccaac
ctgccgacgctggccgcgacggtggccggcaacctgttcgatctcggcgaggtcaccggc
ctgcggctcgactccgtccgcctgcccgccgcgtaccgcaagggcttcgacacgccgcgg
cacggcgtggccggcacgcggcgggtgaccggggtggagcgcggggcgctggtcggctcc
atcatcaagccgaacctcggcctgtcggcggaggagaccggcgagttggtcggcacgctc
tgcgccgccgggctggacttcatcaaggacgacgagatctgcgccgatccgatccacgcc
ccgctggcccagcgcgtgccggcggtgatggaccgggtacgccgccaccaggaccgcacc
ggcaagcacgtcatggtcgccttcaacatcagcgacgagacggacgccatgcgccgccat
gccgatctggtggagcgcgagggcggaagctgcgtgatggtcagcctgaactggtgcggc
ttctccgccgtgcagacgctgcgccgccacagcgggctggtgctgcacgggcaccgcaac
ggcttcggcgccctgtcgcgccaccccagcctgggcatcggcttcgacgcctaccagacg
ctgtggcggctcgccggggtggaccacatgcacgtccacggcctccagggcaagttcgcc
cagcccgacgcggaggtcatcgacggcgccaagtcctgcctcgccccgctggccgaaggc
tgcgacgatacggtgatgccggccttctcctccggccagtgggcgggaaccgttcccgtc
acctgggacgcggtggggacggacgacctgctgttcatgtccggcggcggcatcatggcc
catccggacggccccgccgccggcgtgacgagcatccgtcaggcctgggaggcggtgcgc
gagggcgtcaccctgcccgacgccgccgcgacccggccggagttgaagcgtgccctggag
ttcttcggagcgggcaagtga

DBGET integrated database retrieval system