KEGG   Azospirillum brasilense Sp245: AZOBR_p280087Help
Entry
AZOBR_p280087     CDS       T02152                                 

Gene name
glpD
Definition
(GenBank) sn-glycerol-3-phosphate dehydrogenase FAD/NAD(P)-binding (aerobic)
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
abs  Azospirillum brasilense Sp245
Pathway
abs00564  Glycerophospholipid metabolism
abs01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:abs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AZOBR_p280087 (glpD)
Enzymes [BR:abs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AZOBR_p280087 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 NAD_binding_8 Pyr_redox 3HCDH_N GIDA
Motif
Other DBs
NCBI-ProteinID: CCD02201
UniProt: G8AW92
LinkDB All DBs
Position
AZOBR_p2:858790..860331
Genome map
AA seq 513 aa AA seqDB search
MAGVYDLAIVGGGINGCGIARDAAGRGCSVYLCEQKDLASGTSSASTKLIHGGLRYLEYY
EFRLVREALREREVLWRMAPHIIWPLRFVLPHLPGLRPSWFLRLGLFLYDHLGGREKLPG
TRGLDLRNDPAGKPLKPGFGRAFEYSDCWVDDARLVVLNAQDAARMGATIRTRTRFLNAV
REDGLWTVTVEDTRSGQRSSIRARALVNAAGPWVSEVMRQGARSTVDARIRLVQGSHIVV
PKLFDHDRCYIFQNADKRIVFAIPYERDFTLIGTTDNDYQGDPADVRASEAEIAYLCAAA
GDYFAKPVTPADVVWTYSGVRPLYDDGASTAQAATRDYVLALDAPGDGKAALLNIFGGKI
TTYRRLADAAIAKLAPFLPKLAPGASDWSSAGTLPGGDFPADGVATLISELRGRAPFLTQ
PHLERLARTYGTRARRILDSAARTEDLGRDFGGTLTEAEVRYLMTEEWAETAEDVLWRRT
KLGLRLDAAQAQALDAFMTEERSRRERASDAAE
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggccggggtctacgaccttgccatcgtcggcggcggcatcaacggctgtggcatcgcg
cgcgatgccgcgggacgcggctgctccgtctatctgtgcgaacagaaggatctggcgtcg
ggcacgtcctcggcctcgaccaagctgatccacggcggcctgcgctacctggaatattac
gagttccggctggtccgcgaggcgctgcgcgagcgcgaggtgctgtggcgcatggcgccg
cacatcatctggccgctgcgcttcgtcctgccgcacctgcccggcctgcggccctcctgg
ttcctgcggctcggcctgttcctctacgaccatctcggcgggcgggagaagctgccgggc
acgcgtgggctcgatctgcgcaacgatccggcggggaagccgctgaagcccggtttcggt
cgcgctttcgaatattcggattgctgggtcgacgacgcgcgtctggtggtgctgaacgcg
caggacgccgcccgcatgggcgcgacgatccgcacccgcacccgtttcctgaacgccgtc
cgcgaggacgggctgtggaccgtgacggtggaggacacgcgcagcggccagcgcagcagc
atccgcgcccgcgcgctggtcaacgccgccggcccctgggtgtcggaggtgatgcggcag
ggggcgcggtccacggtggacgcgcgcatccgtctggtccagggctcgcacatcgtggtg
ccgaagctgttcgaccacgaccgctgctacatcttccagaacgccgacaagcgcatcgtc
ttcgccatcccttacgagcgcgacttcaccctgatcggcaccaccgacaacgactaccag
ggcgatccggcggacgtccgcgcgtcggaggcggagatcgcctatctctgcgccgccgcc
ggggactatttcgccaaaccggtgaccccggccgacgtggtgtggacctattccggcgtc
cgcccgctctacgacgacggcgcctcgacggctcaggcggcgacccgcgactatgtgctg
gcgctcgacgcgccgggcgacggcaaggcggcgctgctcaacattttcggcggcaagatc
accacctaccgccgtctggccgacgcggccatcgccaagctggcgcccttcctgccgaag
ctcgctccgggcgcctcggactggagcagcgccggcaccctgccgggcggcgatttcccg
gcggacggcgtcgcgacgctgatttccgaactgcgcgggcgggcgcccttcctgacccag
ccgcatctggagcggctggcgcgcacctacggcacccgcgcccgcaggattctcgacagc
gccgcacggacggaggatctgggccgcgacttcggcgggactctgaccgaggccgaggtc
cgctatctgatgacggaggagtgggcggagaccgccgaggacgtgctgtggcgccggacc
aagctggggctgcggctggacgccgcccaggcccaggcgctcgacgccttcatgaccgag
gagcgcagccggagggagagggcatccgacgctgccgaatag

DBGET integrated database retrieval system