KEGG   Azospirillum brasilense Sp245: AZOBR_p50035
Entry
AZOBR_p50035      CDS       T02152                                 

Definition
(GenBank) putative histidine kinase
  KO
K02482  two-component system, NtrC family, sensor kinase [EC:2.7.13.3]
Organism
abs  Azospirillum brasilense Sp245
Brite
KEGG Orthology (KO) [BR:abs00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:abs01001]
    AZOBR_p50035
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:abs02022]
    AZOBR_p50035
Enzymes [BR:abs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     AZOBR_p50035
Protein kinases [BR:abs01001]
 Histidine kinases
  NtrC family
   AZOBR_p50035
Two-component system [BR:abs02022]
 NtrC family
  Unclassified
   AZOBR_p50035
SSDB
Motif
Pfam: HATPase_c HisKA HATPase_c_3 HATPase_c_2 HATPase_c_5
Other DBs
NCBI-ProteinID: CCD03808
UniProt: G8B0U9
LinkDB
Position
AZOBR_p5:complement(38831..39913)
AA seq 360 aa
MDTRDVVDLQVFMLAAGATGLLLGALGSTRMELLGRNANLVRAIEEAPLGIALLEHHSDR
LSVAFANPTFLRFTPDAVPILLRLQQIPEFEGDVPSSGRTLHWTVKPASASPPGETLIAI
VRDVTEQRRREHAEQHQRRMVAIGEIAGGMAHELNNLLHPIINLSQQARKDAVTKPERLS
KALSIIEDSARGSARLVRQVLSFARNEEEIGGGTELVAALRDSIALLTSTLPPTFAIMLT
HDVPAALVNLTRTEVTQIVTNLVVNALDATDQRGHVTLHVGQPANGSVTVTVKDDGPGIS
AEDAERIMEPFFTTKPHGRGTGLGLAVVRDLLLRRNGSIKLTTQAPQGACFVLSIQSTAE
NT seq 1083 nt   +upstreamnt  +downstreamnt
ttggacacccgcgatgtggtcgatcttcaggtgttcatgctggccgcaggagcgacaggc
ttgcttttgggggccttaggcagcacacgcatggaactgctcggcaggaatgccaacttg
gtccgcgccatagaggaagcgccgttgggcattgccctgctggagcatcattctgaccgg
ctgagcgtcgccttcgccaatccgaccttccttcgcttcacccctgacgccgtgcctatt
ctcctgcggcttcagcaaatccctgagtttgagggagacgtgccgtcgagtggacggacg
ttgcactggacggtcaagcccgcatcagcctcaccaccgggggagacgctgattgccatt
gtgcgggacgtgacggagcagcgtcggagggaacacgcagagcagcatcagcgccgcatg
gtcgccatcggagaaattgccggcggcatggcgcatgaactcaacaacctgcttcacccc
atcatcaatctcagccagcaagcccgcaaagatgccgtcaccaaaccagaacggctcagc
aaggccctcagcatcatcgaggacagcgcccgtgggtccgcccggctggtccgtcaggta
ctgtcctttgcccgcaatgaggaagagatcggaggaggcacagaactggtcgccgctctg
cgcgactcgattgcgctactgacatcgacgctcccgcccaccttcgcaatcatgttgact
cacgacgtgccggcagccttggtcaacctgacacggacggaagtcacccagatcgtcacg
aaccttgtggtaaacgcgctggatgcgaccgaccagagaggccacgtcacccttcacgtc
ggccagcccgcaaacgggtccgtaaccgtgactgtcaaggacgatggtcccggcatctcc
gcagaggacgcggagcgcatcatggagccgttcttcaccaccaagccgcatggacgcgga
acgggcttggggttggcggttgtgcgtgacctcctgttgcgtcgtaatggctccatcaag
ctcaccactcaggctccccaaggtgcatgctttgtgctatctattcagagcactgctgag
tga

DBGET integrated database retrieval system