KEGG   Arcobacter butzleri ED-1: ABED_1718Help
Entry
ABED_1718         CDS       T01823                                 

Definition
(GenBank) penicillin-binding protein 1A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
abt  Arcobacter butzleri ED-1
Pathway
abt00550  Peptidoglycan biosynthesis
abt01100  Metabolic pathways
abt01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:abt00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ABED_1718
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ABED_1718
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:abt01003]
    ABED_1718
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:abt01011]
    ABED_1718
Enzymes [BR:abt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     ABED_1718
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ABED_1718
Glycosyltransferases [BR:abt01003]
 Polysaccharide
  Bacterial polysaccharide
   ABED_1718
Peptidoglycan biosynthesis and degradation proteins [BR:abt01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   ABED_1718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase HemS Phage_XkdX
Motif
Other DBs
NCBI-ProteinID: BAK71435
UniProt: A0A0M1UP33
LinkDB All DBs
Position
1781011..1782990
Genome map
AA seq 659 aa AA seqDB search
MMKYIFGLAVVLGLAVAGFLYDLYDQIKDDVDKVVNYSPKQSTQFFDKEGRLLANTFKDE
NREYVKYDDIPARVIEGLVAIEDTQFFEHWGINPDAISRAMIKNLKAGGFVEGASTLTQQ
LIKNLTLTREKKLMRKVKEALLAIRLETILTKEEILERYLNHTYFGHGYYGIKTAAKGYF
NKDLYELSLKEIAILVGLPRAPSFYDPTRNLQVSLARANQVITRLDTLGWITKEQYEEAI
NETPTIHNQTLTKNVAPYAIDYAISQLINDVPDIIYGGYKVYLTIDLDAQEMANDSIKRA
YEEALKRDLEIRKNSKDPDNNPYTKELNAAMITMESSTGKILAMVGGVDYNQSVFNRAFQ
SKRQAGSAIKPFLYQTALNEGYNPASQLFDISRTYNYTVGGVQKKWQPKNYGGNFQGIVT
LRDSLTQSRNLSTLNLVTDVGVGVVTNDLKTYGFKDIVDNLSITLGSMSVSLVEFSEAYS
TFANNGTQVKPYIVEQIVNKDGKSVTFEPQTKEINKPEQNYLMVSILNDVVNKGTGKRAA
VEGIELAGKTGTTNDNIDAWFCGFSPSIQTIVWFGQDDNTPMRKSETGSTLAAPAFSYFF
KKYLVLHPEIPRTFTKPEGVYVGNFNGKDELYTDMSPLPDIDSQILIDQSNSNEEVLEF
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaatatatttttggtttagctgttgttttaggacttgcagttgcaggttttcta
tatgatttgtacgatcaaataaaagatgacgttgataaagttgtaaactattctccaaaa
caaagtacacagttctttgataaagaaggaaggcttttagcaaatacttttaaagacgaa
aatagagaatatgtaaaatatgatgatattcctgctcgtgtaatagaaggattagttgct
attgaagatacacaattttttgaacattggggaataaatcctgatgcaattagtcgtgct
atgataaaaaacttaaaagctggtggttttgtagaaggtgcgagtacattaactcaacaa
cttataaaaaatcttactttaactagagaaaaaaagttaatgagaaaagttaaagaagcc
ctacttgcaattagacttgaaactattttaacaaaagaagaaattttagaaagatattta
aatcatacatattttggacatggttattatggaataaaaactgctgcaaaaggttatttt
aataaagatttatacgaattatctttaaaagagatagctattttagtaggtcttccacga
gctccaagtttttatgatccaacaagaaatcttcaagtttcattagcacgggctaatcaa
gttattacaagactggatactttaggttggattacaaaagaacaatatgaagaagctata
aatgaaacaccaactatccacaatcaaactttgacaaaaaatgttgctccttatgctatt
gattacgcaataagccaattaataaatgatgttccagatattatttatggtggatataaa
gtttatttgacgattgatttagatgctcaagaaatggcaaatgattctataaaaagagct
tatgaagaggctttaaaaagagatttagaaataagaaaaaattctaaagacccagataat
aatccttatacaaaagagctaaatgcagcaatgatcacaatggaaagtagtacaggaaaa
atattagcaatggttggaggagttgattataatcaatcagtattcaatagagcattccaa
tcaaaaagacaagctggaagtgcaataaaaccatttttataccaaacagctttaaatgaa
ggttataatcctgctagccaactttttgatatttcaagaacatataactatacagtaggt
ggtgttcagaaaaaatggcaaccaaaaaattatggaggaaatttccaaggtattgtgaca
ctaagagattctttaacacaatcaagaaacttatcaactcttaacttagtaactgatgtt
ggagttggagttgttacaaacgatttaaaaacatacgggtttaaagatatagttgataat
ttatctataactttaggttcaatgagtgtatctttagttgaatttagtgaagcatacagt
acttttgcaaataatggaacacaagtaaaaccatatattgttgaacaaattgtaaataaa
gatgggaaaagtgtaacttttgaacctcaaacaaaagagataaataaacctgaacaaaat
tatttgatggtttcaattttaaatgatgttgtaaataaaggaacaggaaaaagagcagca
gttgaaggaatagagcttgcgggtaaaactggaactacaaacgataatattgatgcttgg
ttttgtggattctcaccatcaattcaaacaatagtttggtttggacaagatgataatact
cctatgagaaaaagtgaaacaggaagtactttagcagctccagcattttcatacttcttt
aaaaaatatctagtacttcatcctgaaattcctagaacatttacaaaaccagaaggtgtt
tatgttggcaattttaatgggaaagatgaactatatacagatatgtctcctttaccagat
attgattcacaaattctaatagaccaatcaaattcaaatgaagaagttttagagttttaa

DBGET integrated database retrieval system