KEGG   Arcobacter butzleri ED-1: ABED_1930Help
Entry
ABED_1930         CDS       T01823                                 

Definition
(GenBank) enoyl-(acyl carrier protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
abt  Arcobacter butzleri ED-1
Pathway
abt00061  Fatty acid biosynthesis
abt00780  Biotin metabolism
abt01100  Metabolic pathways
abt01130  Biosynthesis of antibiotics
abt01212  Fatty acid metabolism
Module
abt_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:abt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ABED_1930
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ABED_1930
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    ABED_1930
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:abt01004]
    ABED_1930
Enzymes [BR:abt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     ABED_1930
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     ABED_1930
Lipid biosynthesis proteins [BR:abt01004]
 Fatty acid synthase
  Component type
   ABED_1930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: BAK71647
UniProt: A0A0M1UQW6
LinkDB All DBs
Position
2003085..2003906
Genome map
AA seq 273 aa AA seqDB search
MLMKGKKGVILGVANDKSIAYGIAKACAAQGAKIAFTYLNDALKKRVEPIAAEFGSENLV
YPCDVSKPEEIKALKESLEKDLGEIDFIVHSIAFAPKEGLSGRFYDISKEAFDIAMDVSV
YSLIEVTRELKPLLSNNSSILTLSYYGGVKYIPNYNLMGVAKAALEMTTKYLAEDLGKDG
VRVNAISAGPIKTLAAAGIGDFRFMLKWNEAHSPLKKNVSIDEVGNSGMYLLSDLSSAVT
GEIHYVDSGYNIMGMPAVDFSGEKPKIAWNGEK
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgttaatgaaaggtaaaaaaggtgtaattttaggtgttgcaaatgataagtcaattgct
tacggaatagcaaaagcttgtgcagcacaaggagctaaaatagcttttacatacttaaat
gatgcactaaaaaaaagagttgaaccaattgctgctgaatttggaagtgaaaatttagtt
tatccttgtgatgtttcaaaacctgaagagataaaagcattaaaagagtctttagaaaaa
gatttaggtgagattgattttatcgttcattctattgcttttgctccaaaagaagggtta
agcggaaggttctatgatatttcaaaagaagcatttgatatagctatggatgtttctgtt
tactctttaatagaagttacaagagaattaaaaccacttttatctaataattcatctatt
ttaactctatcttattatggtggagtaaaatacattccaaattataatcttatgggagtt
gcaaaagcggctttagagatgacaacaaaatatcttgcagaagatttaggaaaagatggt
gttagagtaaatgcaattagtgcaggtccaatcaaaactttagcagctgctggaattggt
gatttcagatttatgttaaaatggaatgaagctcattcaccacttaaaaagaatgtttct
atagatgaagtaggaaattcaggaatgtatttacttagtgatttaagtagtgctgtaact
ggtgaaattcattatgttgatagcggatacaatattatgggaatgccagcagttgatttt
tcaggtgaaaaaccaaaaattgcttggaatggagaaaaatag

DBGET integrated database retrieval system