KEGG   Aminipila butyrica: Ami103574_13115
Entry
Ami103574_13115   CDS       T06474                                 

Gene name
pylD
Definition
(GenBank) 3-methylornithyl-N6-L-lysine dehydrogenase PylD
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
abut  Aminipila butyrica
Pathway
abut00300  Lysine biosynthesis
abut01100  Metabolic pathways
abut01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:abut00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Ami103574_13115 (pylD)
Enzymes [BR:abut01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     Ami103574_13115 (pylD)
SSDB
Motif
Pfam: ELFV_dehydrog TrkA_N 3HCDH_N 2-Hacid_dh_C Sacchrp_dh_NADP VID27_PH ThiF
Other DBs
NCBI-ProteinID: QIB70173
LinkDB
Position
complement(2761820..2762632)
AA seq 270 aa
MTRLRTEWIEHMLDGMDDYNRQLQDKIGLNLAELTCKTWHLTEAEFEKARNNHRIAIVPV
TQGEGIISAFSQSVAAIVYSMGFQAFVTGCSDVDGIWEGTKQGCDIFFLADDTRYLALNI
KSGKASDNNYATALGFINALKALMNKKGKDIYQEKILQIGYGAVGKEAAEILLKEKVDFH
LFDIDMEAVQNVSRHKLTETSQLKEYQYMLDFTNQGGWMKKAFLHPDLLYASPGVPHSMD
EETRSYYQDRAVHDNLEIGTAIMLGQIIAG
NT seq 813 nt   +upstreamnt  +downstreamnt
atgaccagattgagaacggaatggattgagcatatgctggatggaatggatgactataat
cggcagttgcaggacaagattggcttgaatctggcagagttgacctgcaagacttggcat
ctgacagaggcagagtttgaaaaggccaggaacaatcatcggattgccatcgtgcctgtt
acccagggagagggcattattagcgcttttagtcaatctgtggcggccattgtgtactcc
atgggatttcaagcctttgttacgggatgcagtgatgtagacggcatttgggaaggaacg
aaacaggggtgtgatatattctttttagcggatgataccagatatctggctttgaatatc
aaaagcggaaaagcatccgacaacaattatgccacggctttgggtttcatcaatgctttg
aaagctttgatgaataaaaaaggaaaagatatttatcaggagaagattttgcagattggt
tatggcgccgtgggaaaagaggcggctgagatattgctgaaagaaaaggttgactttcat
ctgtttgatattgatatggaagctgtacaaaatgtatcccgtcataagctcacagaaacg
agtcagctgaaagaataccaatacatgctggattttactaatcaaggaggctggatgaag
aaggcctttcttcatccagatcttctatatgccagtccgggggtgccccactccatggat
gaagagacacgcagttattatcaagatcgggcggttcacgacaacctggaaatcggaacg
gccatcatgctgggacaaataattgctggctga

DBGET integrated database retrieval system