KEGG   Agaricus bisporus var. bisporus H97: AGABI2DRAFT138513Help
Entry
AGABI2DRAFT138513 CDS       T03140                                 

Gene name
AGABI2DRAFT_138513
Definition
(RefSeq) hypothetical protein
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
abv  Agaricus bisporus var. bisporus H97
Pathway
abv00020  Citrate cycle (TCA cycle)
abv00480  Glutathione metabolism
abv01100  Metabolic pathways
abv01110  Biosynthesis of secondary metabolites
abv01130  Biosynthesis of antibiotics
abv01200  Carbon metabolism
abv01210  2-Oxocarboxylic acid metabolism
abv01230  Biosynthesis of amino acids
abv04146  Peroxisome
Module
abv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abv_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:abv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AGABI2DRAFT138513 (AGABI2DRAFT_138513)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AGABI2DRAFT138513 (AGABI2DRAFT_138513)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AGABI2DRAFT138513 (AGABI2DRAFT_138513)
Enzymes [BR:abv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AGABI2DRAFT138513 (AGABI2DRAFT_138513)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 18078662
NCBI-ProteinID: XP_006455281
JGI: Agabi_varbisH97_2_138513
LinkDB All DBs
Position
Unknown
AA seq 419 aa AA seqDB search
MSKKIVVKNPVVELDGDEMTRIIWKKIREELILPYLQLDLKYYDLGLEYRDKTNDQVTIE
AAKAIQKYNVGVKCATITPDEARVEEFKLKEMWKSPNGTIRNILGGTVFREPIILQRIPR
PIPGWVKPICIGRHAFGDQYRSTDYVVPGPGKLQLVFTPKDGSQPVSMNVFDFEGPGVAM
SMYNTDESITGFAHASFKMAISKKMPLFMSTKNTILKRYDGRFKDIFQEIYESTYKPQFE
AAGIYYEHRLIDDMVAQAIKSSGGFVWACKNYDGDVQSDILAQGFGSLGMMTSELLTPDG
QIIESEAAHGTVTRHYREWQKGNETSTNPVASIFAWTRGLLHRAKLDKNEPLKQFCLDLE
SACVEVIDKDGVMTKDLAIAIHGVKNVKREHWVITDAYLDAVNAKLRRKLSDRGLGTKL
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaaagattgtcgtgaagaatcccgttgtggagctggatggcgacgagatgacc
aggatcatctggaaaaagatccgagaagagctcattctcccgtaccttcaacttgacctc
aagtactatgatctaggcctggaataccgtgacaagacaaacgaccaagttactatcgag
gccgctaaggccattcagaaatataatgttggtgtcaaatgtgcgaccatcactcctgat
gaggcccgtgtagaagagttcaaactgaaggagatgtggaagagtccaaatggcactatt
cgtaacatcctcggaggaactgtcttccgtgaacctatcattctgcagcgtattccccga
cccatcccaggatgggtgaagcctatttgtattggtcgtcatgctttcggtgatcagtac
cgctcgacggactacgttgttcctggacctggaaagctccaactggttttcacccctaag
gatggctctcaaccagtttccatgaacgtgttcgatttcgaaggacctggtgttgctatg
agcatgtacaatactgacgaatccatcactgggtttgcgcacgcttctttcaaaatggcc
atttccaagaaaatgcccttgttcatgtctacgaaaaacaccatcctgaagagatatgat
ggtcgcttcaaagacatcttccaggagatctatgaatcaacctacaaacctcaatttgaa
gccgctggcatctattacgaacatcgtttgatcgacgacatggtcgcccaagccattaaa
tcctcgggtggtttcgtttgggcctgcaaaaactacgatggcgacgtccaatccgacatt
ctcgctcagggtttcggttccctcggtatgatgacttcagaactcttgacacccgacggt
caaatcatcgaatccgaagctgctcatggaacagttacaaggcattatcgggaatggcaa
aagggtaatgagacgtcgactaatcctgttgcatccatttttgcttggacgagagggttg
ttgcatagggcgaagcttgataagaatgagcctttgaaacagttttgtttggacttggag
agcgcttgtgttgaggttattgataaggatggtgtgatgaccaaggatcttgcgattgcg
attcatggagtcaagaatgtgaagagggaacactgggttatcacggatgcctacctggac
gccgtcaatgccaagctgcggaggaagctctcagatcgcggtttagggaccaagctttaa

DBGET integrated database retrieval system