KEGG   Agaricus bisporus var. bisporus H97: AGABI2DRAFT152937Help
Entry
AGABI2DRAFT152937 CDS       T03140                                 

Gene name
AGABI2DRAFT_152937
Definition
(RefSeq) hypothetical protein
  KO
K11405  histone deacetylase 8 [EC:3.5.1.98]
Organism
abv  Agaricus bisporus var. bisporus H97
Brite
KEGG Orthology (KO) [BR:abv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:abv03036]
    AGABI2DRAFT152937 (AGABI2DRAFT_152937)
Enzymes [BR:abv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     AGABI2DRAFT152937 (AGABI2DRAFT_152937)
Chromosome and associated proteins [BR:abv03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     AGABI2DRAFT152937 (AGABI2DRAFT_152937)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 18079385
NCBI-ProteinID: XP_006463921
JGI: Agabi_varbisH97_2_152937
LinkDB All DBs
Position
Unknown
AA seq 400 aa AA seqDB search
MSSSTTTARVAYIVSAQLIKIASLLPSNKKRSFVVHSLIKSLGLLEPGKVQIYTPRNATR
QDLAMYHASGYLEFILDPKNCNEHDEHRHDASEWEAMKVEYGLEDDCPLFTGLSDYVTLV
AGATLTAVDALRYDISDIAINWDGGRHHASKSRASGFCYVADCVLAILALKSIPRPPSKA
NEPTKPLPRVLYLDLDLHFSDSVSAAFTIHHTSPGFFPVSPKAELPDPSTARFDPFNLSI
PLREGASNKTYCAIWGIVEGLKDIMMPDFIVIQCGTDALAGDPCATLNWSLGGGEGSLGW
CVSRIINEWKGKKLFLGGGGYNSANAARAWAYITSVALGNPLDLEAHIPDHPGFPLYAPS
FTLDVPAGNMRDQNSPEYLHTIRTRFDKVIPLVRQRIGCA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcttcgaccacgacggcccgtgtcgcgtatatcgtttcagctcagctcatcaag
atagcctcgctccttccgtccaataaaaaacgatcattcgttgttcacagtctcataaag
tctcttggtctgctcgaaccaggcaaagttcagatatacacacctcgaaatgcgactcga
caagacctcgccatgtaccacgcgtcaggatatctggaatttattctcgacccgaaaaac
tgcaatgagcacgacgaacacagacacgacgcgtcagaatgggaggctatgaaagtggaa
tacggtcttgaggatgattgcccgttgtttaccggcttatcagattatgtgacactagtt
gcaggtgcaaccctgacagccgtcgatgcattaagatatgatataagcgatattgccatc
aattgggacggggggaggcatcatgcatccaaatcccgtgcttcagggttctgttatgtt
gccgattgcgtcttagcaatactcgctctcaaatctattcctcgtccaccatcgaaagca
aacgaacccacaaaacctctcccgagagttctctatctcgacttggatctccatttctct
gacagtgtctctgctgcgtttaccattcatcatacatcacccggctttttcccagtatct
ccaaaagcagaactaccagatccatctacagctcgtttcgatccattcaatctaagcatc
cctcttcgcgaaggggcctccaacaaaacatactgcgcgatatggggcatcgtagaaggg
ctcaaagatatcatgatgcccgattttatcgttatacagtgtggtacagatgctctggca
ggtgatccctgtgcaactctgaattggtctttgggcggtggagagggttcactaggttgg
tgtgtctcgcggataattaatgagtggaagggaaagaagttgtttcttggcggtggtggc
tacaattctgcaaatgcggcgcgagcgtgggcgtatataacatcagttgcgctcggaaac
cccttggatctggaagctcatatacccgatcatcctggtttcccgctatacgcaccgtca
ttcactctcgacgtgcctgcagggaacatgcgcgaccagaactcacctgagtatttgcat
actatcagaacacggttcgacaaagtcattccgcttgttcgtcaaaggataggttgtgct
tga

DBGET integrated database retrieval system