KEGG   Agaricus bisporus var. bisporus H97: AGABI2DRAFT183499Help
Entry
AGABI2DRAFT183499 CDS       T03140                                 

Gene name
AGABI2DRAFT_183499
Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
abv  Agaricus bisporus var. bisporus H97
Pathway
abv00250  Alanine, aspartate and glutamate metabolism
abv00410  beta-Alanine metabolism
abv00430  Taurine and hypotaurine metabolism
abv00650  Butanoate metabolism
abv01100  Metabolic pathways
abv01110  Biosynthesis of secondary metabolites
Module
abv_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:abv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AGABI2DRAFT183499 (AGABI2DRAFT_183499)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AGABI2DRAFT183499 (AGABI2DRAFT_183499)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AGABI2DRAFT183499 (AGABI2DRAFT_183499)
   00430 Taurine and hypotaurine metabolism
    AGABI2DRAFT183499 (AGABI2DRAFT_183499)
Enzymes [BR:abv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AGABI2DRAFT183499 (AGABI2DRAFT_183499)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 18080377
NCBI-ProteinID: XP_006458463
JGI: Agabi_varbisH97_2_183499
LinkDB All DBs
Position
Unknown
AA seq 506 aa AA seqDB search
MSLAKASIAYTRSSRDSFSGSMSTPGVEEDTAYRMIHDELTLDGSTLLNVASFVQTYMPP
CADKLVKENISKNLIDADEYPATQMMHSRCVSMIADLWHAPSAKEAIGTATTGSSEAVHL
GGLAMKKIWQKARKAAGKSIHEPGPNIVMSANAQVALEKFARYFDVECRLVPVSEESRYH
LDVKKAMEYIDENTIGVFVILGSTYTGHYEDVKALAELLDDFEARSGCSVPIHVDAASGG
FIVPFTHSDLLWDFRIPRVVSINASGHKFGMTYVGVGWIIWRDKAHLPEDLVFELHYLGS
TEFTFSLTFSRGAAPIVAQYFNLLHLGFQGYRKVALDNFKNARSLSRALEKSGYFVVLSD
IHRAKGTRNGHGIDSPNFEDYEAGLPVVAFKFSDEFKKCFPHLQQKWIQTLLRTRGWLIP
NYNLCPDCQDIEILRVVVKENMTEMLVQRFIDNLFDVIEVLTSDKEAQRSFLSPIDTSRV
DSDQRLHGIQIRPEESKHSGTYARPC
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgtctcttgccaaggcgagtatagcatacaccaggtcatctcgagactcattttctggt
agcatgtcgacaccaggtgtcgaagaagatacggcgtaccggatgattcacgatgaactt
acgctagatggttcaacgctactcaatgtagcctcctttgtccagacgtacatgccaccc
tgcgcagacaagctcgtcaaggagaatatatcgaagaacttgattgatgctgatgagtat
cccgccacccaaatgatgcattcacgatgcgtctcgatgattgccgacttgtggcatgcg
ccgtctgctaaggaagctattggcactgcaacgacaggttcctccgaggctgtccacctt
ggggggttggcgatgaaaaagatttggcagaaagcacgcaaagcggcgggcaagagtatc
cacgagccaggacctaacattgtcatgagtgccaatgcccaggttgctctagagaagttc
gcgaggtacttcgacgtcgagtgtcgattggttccggtatccgaggaaagccgatatcac
cttgacgtcaagaaagctatggagtacatcgacgagaacactattggtgtattcgtcatt
ctaggaagtacctacacaggtcattatgaagatgtcaaagctcttgccgaacttttggat
gattttgaagctcggtcgggttgttcggtcccgattcatgtggatgcagcttccggtgga
ttcattgttccattcacccattcggatctgctctgggattttagaatcccccgagtagtc
tcaatcaatgcctctggtcataaatttggtatgacttacgttggagttggatggatcatc
tggcgcgacaaggcacatttgcccgaagatcttgtcttcgagctccactacctcggctct
actgaatttactttctctttgactttttctcgtggcgcggccccgatagtcgcccaatac
ttcaatcttctgcacttgggtttccagggctatcgcaaggttgcgcttgataattttaag
aacgctcggtcgttgagtcgagccttggagaaaagtggatattttgtagtgctgtcagat
atccacagggccaagggcactcgaaacgggcatggaatcgattcgccaaattttgaggat
tacgaggcaggacttccagtcgtcgccttcaagttttcggatgagttcaaaaagtgtttt
cctcatttgcaacaaaagtggatacagactctcttgcgcacacggggctggctcattccc
aattataacttatgtcctgattgccaagacattgaaatattacgagtagtagtcaaagaa
aatatgactgagatgctcgtccaacgctttattgataacctctttgatgtcatcgaggtg
ttgacgagtgataaagaagctcaacgatcgttcctttcgccgatcgatacatctcgggtt
gattcagaccagaggctgcatgggatccagatcaggccagaagaaagcaagcattcaggt
acatatgctagaccctgttaa

DBGET integrated database retrieval system