KEGG   Agaricus bisporus var. bisporus H97: AGABI2DRAFT183688Help
Entry
AGABI2DRAFT183688 CDS       T03140                                 

Gene name
AGABI2DRAFT_183688
Definition
(RefSeq) hypothetical protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
abv  Agaricus bisporus var. bisporus H97
Pathway
abv00052  Galactose metabolism
abv00500  Starch and sucrose metabolism
abv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AGABI2DRAFT183688 (AGABI2DRAFT_183688)
   00500 Starch and sucrose metabolism
    AGABI2DRAFT183688 (AGABI2DRAFT_183688)
Enzymes [BR:abv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     AGABI2DRAFT183688 (AGABI2DRAFT_183688)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 18080403
NCBI-ProteinID: XP_006458746
JGI: Agabi_varbisH97_2_183688
LinkDB All DBs
Position
Unknown
AA seq 866 aa AA seqDB search
MVALTGSYRHWTLLVLWLRLVSYICATNVDPAVLDACPGYNAQNVKTEGGTLIADLTLAG
EACNVFGDDLTALSLRVDYETKDRIHLKIVDANSSRYEVPESVFPRPSNQAVSPDSASIQ
FNFTTSPFTFSIYRSSSQEVLFSTASHPIIFEPQYLRVKTNLPDNANIYGFGEHTNPFHL
PTDNMTLTLWSKESPGLPTGTNLYGNHPVYFEHRTTGTHGVFFLNSNGMDVKLSNTGGTS
LEYNAIGGVMDYYFLAGSESDPAEVARQYAEVAGLPAEVAYWSFGFHQCRFGYKDFVNVA
EVISKYAAAGIPLETMWTDIDYMDRRRIFTVDPQFFPMNRMRDVVDYLHSHDQHFILMTD
PAVAYLPDDPDYLSFHRGKDLNVYLKADNGSDFIAIVWPGRFWNNEFREFYDPETGLDID
GAWIDMNEPSNFCNLPCDDPFQQARDQGLPPPRTSSPPDPNAPIFQNDSQSQLGRRDDIL
NPPYAINNAAGPLSSKTSMTNATHANGLQEYDVHNLYGMMMSIATRTAMLARRPGKRPLI
ITRSTFAGVGAHVGKWLGDNISLWEQYRFSIGGMLNFATIFQVPMVGSDICGFNGNTTET
LCARWATLGAFYPFMRNHNEIHANDQEYYLWPSVTQAAKSSMDIRYRLMDYFYTAFHQAH
TDGTPVLHPLWFKYPKDANTFPLDLQFFFGDSILVSPVTEENSTSVDIYLPDDIFYNFTS
LAPVEGTRSNVSLTNIDFTTIPVHIKGGVVLPLRDEGFEFVVATGQDGTASGSLYIDDGE
SIEPSQTTTVDMSFKEGKLDVKGTFDFPTGVNVARVRFLNVEKAPKKVKVNGKNLGHSRI
KHDATNKVLDVTVDVAFDKDLSVELS
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atggtcgcccttaccggctcctacaggcactggactctcctcgttctgtggttgaggttg
gtttcctacatatgcgctaccaacgtcgatccagctgtcttggatgcatgccccggctac
aacgcgcagaacgtcaagacagaaggcggaacccttatagcagaccttacactagccggt
gaagcctgcaatgtcttcggagatgaccttacagcgctttctctgagagttgactatgaa
accaaggatcgtattcatttgaaaatagtggacgccaactcgagccgctatgaagttccc
gagagtgtgttccctcgaccctccaaccaagcagtgtcgccagattcggcttcaatccaa
ttcaactttacaacctcaccttttacattctcaatctatcggagttcctctcaggaggta
ttattctctactgcttcgcatcctatcatcttcgagccgcaatatcttcgtgtcaagacg
aatctacctgacaatgcgaatatttatggctttggggagcacactaaccccttccatctc
ccaactgacaatatgacgcttaccttatggtcgaaggagtcccccgggcttcccactggt
acaaacttatacggaaatcacccagtctatttcgaacatcgtaccacgggaacacatggt
gtctttttcttgaactccaatggtatggatgtcaagctcagtaacacggggggaactagc
ctggaatataatgccatcggtggcgttatggactattattttttggctggtagtgagtcg
gatccggcagaggttgcaagacaatatgcggaagttgctggtctccctgctgaggtagcc
tattggagtttcggttttcatcaatgccgcttcggctataaagatttcgtcaacgtagct
gaggttatatctaaatatgcagcagcaggcattcctctcgaaactatgtggacggatatt
gattacatggatagacgtcgtattttcactgtagacccgcaattcttcccgatgaacagg
atgcgtgatgtcgtcgactatttacattcccatgaccagcacttcattttgatgactgat
cctgcggtagcctatttaccagatgatccggattatttgtcgtttcaccgtggcaaagac
ctcaacgtatatcttaaagctgacaacggaagtgatttcattgctatcgtttggcccgga
agattttggaacaacgaattccgggaattctacgacccggaaacggggctagatattgac
ggtgcatggattgatatgaacgaaccctctaatttttgcaatctaccctgcgatgaccct
ttccaacaggccagagatcagggtcttcctcctcccaggacaagttcccctcctgatcct
aatgctcctatcttccaaaacgactctcaatctcaacttggcaggcgcgacgatatactc
aacccaccttacgcaatcaataatgccgcgggtccgctttcatcgaagacttctatgacc
aatgcgactcatgctaatgggctgcaggagtatgacgtgcacaatctttatgggatgatg
atgtctattgccacgcgcacagccatgctggctcgtcgtcctggtaaacgaccccttatc
attactcgctctacttttgccggagtcggagcgcatgtcggcaagtggcttggggataac
atcagtctatgggaacagtataggttctccattggtgggatgctgaattttgcgactatc
ttccaagttccgatggttggaagtgacatttgcggatttaatggcaatacaacggagact
ctgtgtgctcgttgggccacgctcggcgctttctatcctttcatgcgcaatcacaacgag
atccacgccaacgatcaagagtattacctttggccttcggtcactcaggcagctaaaagt
tcaatggatattcgttatcgcctaatggactacttctacactgcctttcatcaagcccac
accgatggcacacccgttctccatcccctttggttcaaatatccgaaagacgcaaacacc
ttccctcttgatctgcaattcttcttcggcgattccattcttgtctctcctgtgacagaa
gagaactcgacttctgttgacatataccttcccgacgatatcttctacaactttacctct
ttggctcctgttgaaggtaccagatcaaatgtctctctcaccaacatcgattttacgact
atccccgttcacatcaagggtggtgtcgtgcttcctctccgcgacgaaggctttgagttc
gtcgtagctaccggtcaggatggtactgcctctggcagtctttacatcgacgatggagag
tctatcgagccatctcaaacgactactgtggatatgagtttcaaggagggcaagttggat
gtaaagggaacatttgatttcccaacgggcgttaacgtagcgcgtgtgcggttccttaac
gtggagaaggctcccaagaaagtgaaggttaatgggaaaaatttgggtcactcgcgtata
aagcatgatgcgacgaacaaggtgttggatgtcactgttgatgttgctttcgataaagac
ttatcggtggagctttcatga

DBGET integrated database retrieval system