KEGG   Agaricus bisporus var. bisporus H97: AGABI2DRAFT190526Help
Entry
AGABI2DRAFT190526 CDS       T03140                                 

Gene name
SDH1, AGABI2DRAFT_190526
Definition
(RefSeq) succinate dehydrogenase flavo protein subunit precursor
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
abv  Agaricus bisporus var. bisporus H97
Pathway
abv00020  Citrate cycle (TCA cycle)
abv00190  Oxidative phosphorylation
abv01100  Metabolic pathways
abv01110  Biosynthesis of secondary metabolites
abv01130  Biosynthesis of antibiotics
abv01200  Carbon metabolism
Module
abv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
abv_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:abv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AGABI2DRAFT190526 (SDH1)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AGABI2DRAFT190526 (SDH1)
Enzymes [BR:abv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AGABI2DRAFT190526 (SDH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO Lycopene_cycl HI0933_like
Motif
Other DBs
NCBI-GeneID: 18081491
NCBI-ProteinID: XP_006458173
JGI: Agabi_varbisH97_2_190526
LinkDB All DBs
Position
Unknown
AA seq 625 aa AA seqDB search
MLSRALSRAHRPFLATKAAVRTQSSWSSGKYPLIEHEYDAVVVGAGGAGLRAAFGLAEAG
FKTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIHYMCR
EAPNTVIELEHYGVPFSRTKEGKIYQRAFGGQSLKFGKGGQAYRCAAAADRTGHALLHTL
YGQSLRHDTNFFIEYFALDLIMQDGECVGVIALNMEDGTLHRFRSHKTVLATGGYGRAYF
SCTSAHTCSGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSRGEGGYLLNSEGE
RFMERYAPTAKDLASRDVVSRSMTLEIREGRGVGPEKDHIYLQLSHLPPDILHERLPGIS
ETAAIFSGVDVTKEPIPVLPTVHYNMGGIPTRYTGEVITVDENGQDKIVPGLYAAGEAAS
VSVHGANRLGANSLLDIVVFGRAAAHHIRDTLTPGKPHKDIPQEAGLESIEFLDKIRQSD
GPEPTAKIRLDMQKAMQTDAAVFRTQETLDEGVAKMRQIYNNFEKVGIKDRSMIWNSDLV
ETLELRNILQNAIQTITAAAARKESRGAHAREDFPERDDATWMKHTLSFQPDISTPDVVL
KYRNVIDKTLDENECKPVPPFKRVY
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgctctccagagccctctcccgcgcacatcgcccattcctcgccacaaaagcagccgtc
aggacacagtcctcctggtcatccggcaagtatcccctcatcgagcacgagtatgatgcc
gtcgttgttggtgcaggtggtgccggcctgagggctgcctttggtctcgctgaggctggt
ttcaagactgcctgtatcaccaaactctttcccaccagaagccatactgtcgctgcccag
gggggtatcaatgctgcgcttggtaacatgacagaagacgactggagatggcatatgtat
gatactgtcaaaggctctgactggctcggtgaccaggatgccatccactacatgtgccgg
gaggctcccaacaccgttatcgagctggagcattatggtgttccgttttcacggaccaag
gagggcaagatctatcaacgcgcctttggtggtcagtccctcaaatttggcaagggtggt
caagcctatcgctgcgctgctgctgccgatcgtactggtcatgctctcctccatactctt
tatggccaatcacttcgccatgacaccaactttttcattgaatatttcgctcttgacctc
attatgcaagacggcgaatgtgtcggcgttattgctctgaatatggaggacggtacactt
catcgtttccgcagtcacaaaactgtccttgctaccggaggttacggacgtgcgtacttc
agctgtaccagtgctcacacatgttcgggagacggtaatgccatggttgcacgtgccggt
cttcctctacaagatctggaattcgtccagttccacccaaccggtatctacggtgctggt
tgcttgatcacagaaggttcgcgcggtgaaggaggttatcttctcaactctgagggtgag
cgtttcatggagcgatatgcccccactgccaaggatcttgcatctcgtgacgttgtttct
cgatccatgacacttgaaatccgtgagggccgtggtgttggtcccgagaaagaccatatc
tacctccaactcagccatttgcctcccgacattcttcacgagaggcttcctggtatttct
gaaacggccgctattttctctggtgtcgatgtcaccaaggagcccattcctgtcctccct
actgtccactacaacatgggtggtatccccaccaggtacactggcgaggtcatcaccgtt
gatgagaacggccaagacaagatcgtccctggtctctatgctgctggcgaggctgcttcc
gtctctgtccatggtgctaaccgtctcggagccaactcacttcttgatatcgttgtattc
ggtcgcgctgctgctcatcacatccgcgacacccttactccgggcaagccacacaaggat
attcctcaagaggccggtcttgaaagtatcgagtttttagataagatcagacaatcggat
ggtcctgagcccaccgccaagattcgtcttgacatgcaaaaggccatgcaaactgatgct
gctgtcttcaggactcaggagactcttgatgaaggtgttgccaagatgcgtcaaatctac
aacaactttgaaaaagtgggcatcaaggataggagcatgatttggaactcagatctggtg
gaaactttggaactccgtaatattctacaaaatgccattcaaactatcactgccgctgct
gctcgcaaggagtcccgcggagcacacgctcgggaggacttccccgaacgtgacgacgcg
acctggatgaaacacacactttccttccaacctgatatcagcacccctgatgtggtcctc
aagtaccgtaatgtcatcgacaagaccctcgatgagaacgaatgcaagcctgttcctcct
ttcaagcgtgtctactag

DBGET integrated database retrieval system