KEGG   Agaricus bisporus var. bisporus H97: AGABI2DRAFT190526
Entry
AGABI2DRAFT190526 CDS       T03140                                 

Gene name
SDH1, AGABI2DRAFT_190526
Definition
(RefSeq) succinate dehydrogenase flavo protein subunit precursor
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
abv  Agaricus bisporus var. bisporus H97
Pathway
abv00020  Citrate cycle (TCA cycle)
abv00190  Oxidative phosphorylation
abv01100  Metabolic pathways
abv01110  Biosynthesis of secondary metabolites
abv01200  Carbon metabolism
Module
abv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
abv_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:abv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AGABI2DRAFT190526 (SDH1)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AGABI2DRAFT190526 (SDH1)
Enzymes [BR:abv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AGABI2DRAFT190526 (SDH1)
SSDB
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO Lycopene_cycl HI0933_like
Other DBs
NCBI-GeneID: 18081491
NCBI-ProteinID: XP_006458173
JGI: Agabi_varbisH97_2_190526
LinkDB
Position
Unknown
AA seq 625 aa
MLSRALSRAHRPFLATKAAVRTQSSWSSGKYPLIEHEYDAVVVGAGGAGLRAAFGLAEAG
FKTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIHYMCR
EAPNTVIELEHYGVPFSRTKEGKIYQRAFGGQSLKFGKGGQAYRCAAAADRTGHALLHTL
YGQSLRHDTNFFIEYFALDLIMQDGECVGVIALNMEDGTLHRFRSHKTVLATGGYGRAYF
SCTSAHTCSGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSRGEGGYLLNSEGE
RFMERYAPTAKDLASRDVVSRSMTLEIREGRGVGPEKDHIYLQLSHLPPDILHERLPGIS
ETAAIFSGVDVTKEPIPVLPTVHYNMGGIPTRYTGEVITVDENGQDKIVPGLYAAGEAAS
VSVHGANRLGANSLLDIVVFGRAAAHHIRDTLTPGKPHKDIPQEAGLESIEFLDKIRQSD
GPEPTAKIRLDMQKAMQTDAAVFRTQETLDEGVAKMRQIYNNFEKVGIKDRSMIWNSDLV
ETLELRNILQNAIQTITAAAARKESRGAHAREDFPERDDATWMKHTLSFQPDISTPDVVL
KYRNVIDKTLDENECKPVPPFKRVY
NT seq 1878 nt   +upstreamnt  +downstreamnt
atgctctccagagccctctcccgcgcacatcgcccattcctcgccacaaaagcagccgtc
aggacacagtcctcctggtcatccggcaagtatcccctcatcgagcacgagtatgatgcc
gtcgttgttggtgcaggtggtgccggcctgagggctgcctttggtctcgctgaggctggt
ttcaagactgcctgtatcaccaaactctttcccaccagaagccatactgtcgctgcccag
gggggtatcaatgctgcgcttggtaacatgacagaagacgactggagatggcatatgtat
gatactgtcaaaggctctgactggctcggtgaccaggatgccatccactacatgtgccgg
gaggctcccaacaccgttatcgagctggagcattatggtgttccgttttcacggaccaag
gagggcaagatctatcaacgcgcctttggtggtcagtccctcaaatttggcaagggtggt
caagcctatcgctgcgctgctgctgccgatcgtactggtcatgctctcctccatactctt
tatggccaatcacttcgccatgacaccaactttttcattgaatatttcgctcttgacctc
attatgcaagacggcgaatgtgtcggcgttattgctctgaatatggaggacggtacactt
catcgtttccgcagtcacaaaactgtccttgctaccggaggttacggacgtgcgtacttc
agctgtaccagtgctcacacatgttcgggagacggtaatgccatggttgcacgtgccggt
cttcctctacaagatctggaattcgtccagttccacccaaccggtatctacggtgctggt
tgcttgatcacagaaggttcgcgcggtgaaggaggttatcttctcaactctgagggtgag
cgtttcatggagcgatatgcccccactgccaaggatcttgcatctcgtgacgttgtttct
cgatccatgacacttgaaatccgtgagggccgtggtgttggtcccgagaaagaccatatc
tacctccaactcagccatttgcctcccgacattcttcacgagaggcttcctggtatttct
gaaacggccgctattttctctggtgtcgatgtcaccaaggagcccattcctgtcctccct
actgtccactacaacatgggtggtatccccaccaggtacactggcgaggtcatcaccgtt
gatgagaacggccaagacaagatcgtccctggtctctatgctgctggcgaggctgcttcc
gtctctgtccatggtgctaaccgtctcggagccaactcacttcttgatatcgttgtattc
ggtcgcgctgctgctcatcacatccgcgacacccttactccgggcaagccacacaaggat
attcctcaagaggccggtcttgaaagtatcgagtttttagataagatcagacaatcggat
ggtcctgagcccaccgccaagattcgtcttgacatgcaaaaggccatgcaaactgatgct
gctgtcttcaggactcaggagactcttgatgaaggtgttgccaagatgcgtcaaatctac
aacaactttgaaaaagtgggcatcaaggataggagcatgatttggaactcagatctggtg
gaaactttggaactccgtaatattctacaaaatgccattcaaactatcactgccgctgct
gctcgcaaggagtcccgcggagcacacgctcgggaggacttccccgaacgtgacgacgcg
acctggatgaaacacacactttccttccaacctgatatcagcacccctgatgtggtcctc
aagtaccgtaatgtcatcgacaagaccctcgatgagaacgaatgcaagcctgttcctcct
ttcaagcgtgtctactag

DBGET integrated database retrieval system