KEGG   Agaricus bisporus var. bisporus H97: AGABI2DRAFT192455Help
Entry
AGABI2DRAFT192455 CDS       T03140                                 

Gene name
AGABI2DRAFT_192455
Definition
(RefSeq) hypothetical protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
abv  Agaricus bisporus var. bisporus H97
Pathway
abv00500  Starch and sucrose metabolism
abv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AGABI2DRAFT192455 (AGABI2DRAFT_192455)
Enzymes [BR:abv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     AGABI2DRAFT192455 (AGABI2DRAFT_192455)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 18082160
NCBI-ProteinID: XP_006460867
JGI: Agabi_varbisH97_2_192455
LinkDB All DBs
Position
Unknown
AA seq 574 aa AA seqDB search
MRISSAFLWTSLALSWGAYAQSSSVDAYLAAESPIAKAGLLANIGPSGSKSAGAKAGIVI
ASPSHSDPDYLFTWTRDASLVFAVIIDQYTLGLDTSLRSHIDNFVSSQKIIQQVSNPSGT
ISTGGLGEPKFNIDETAFTGSWGRPQRDGPALRANALITWSNHLLKQNNASYVTGTLWPI
IKLDLDYIKNTWNQSSFDLWEEVSSSSFFTTAVQHRSLRQGAALATAIRETSVVADYTKQ
ADNLLCFMQSYWNTAGYMTANTGGGRTGKDANTVLASIHTFDAAAGCDAATFQPCSDRAL
ANLVAYVNAFRSIYAINSGVPSNIGIATGRYAEDVYFGGNPWYLTTLAVAEQLYDALIVW
KNQGSITVTNLSKPFFSLFSSGISTGTFSSSSSTFNTLITGVQNYADSFVNVVAKHTPSG
GGLAEQYSRNDGNPLSAFDLTWSYASLLTADGARNGVVPASWGAKGLTVPGTCSGNSGPT
AHVTFNVNAETVFGENIFVTGSVGALANWSPDNAIALNADNYPIWSVAIDIPASTNVEYK
YIRKFNGGVTWESDPNRRFTSPASGSSTLNDVWR
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatttcttcagcattcctctggactagtttggcgctctcatggggagcctatgca
cagtccagttctgttgatgcatatctagccgctgaatccccgatagccaaagcaggtcta
cttgccaacattggaccttctggttccaagtcagcaggtgctaaagcaggaatagtaatc
gcctctccatcacattcggaccctgactatctgtttacctggactcgtgatgcctcgctc
gtgtttgcggtaatcattgaccaatacacgttgggtctggatacttctctgcgaagtcat
atcgataattttgtttcctcacaaaagattatacaacaagtgtctaatccatcgggaacg
attagtaccggtggcctcggtgaaccaaagtttaacatcgatgaaacggctttcactggt
tcatggggtcgtcctcaacgagatggtcctgccctaagagccaatgctctcatcacctgg
tcgaatcaccttcttaaacaaaacaacgcgtcctacgtcactggcacattgtggcccatc
atcaagctcgacctcgactacataaaaaatacctggaatcagtctagtttcgacttgtgg
gaagaagtatcatcctcgtctttcttcaccactgccgtgcaacaccgttcactccgccaa
ggcgcagcattggccactgcaatccgcgaaacttctgtcgtggccgattatacaaaacaa
gcggacaaccttctgtgcttcatgcagtcatactggaatacagcaggttatatgactgca
aacacgggtggtggtcgtacaggtaaagatgcaaatactgttctcgctagtatccacacc
ttcgatgctgctgctggttgcgacgctgccactttccaaccttgctctgaccgtgccctg
gccaatctcgtcgcatacgttaacgccttccgaagcatatatgccatcaactcgggtgtt
ccatcaaacatcggtattgcgactggaagatatgcagaggatgtgtatttcggtgggaat
ccatggtacttgacgactttggcggttgcggaacaactctatgatgctttgatcgtctgg
aaaaaccaaggctcaatcacagtcacgaatctatccaagccattcttttcactcttctcg
tctggcatttctaccggcactttttcttcttcttccagcaccttcaatactctgattaca
ggagtccaaaactatgccgatagcttcgtgaatgtcgttgcgaagcatacaccctctggt
ggaggccttgctgagcagtacagccgcaatgacgggaatcctctcagtgcatttgatttg
acttggagctatgcttccctcttaacggctgatggtgccagaaatggtgttgttcctgcg
agttggggtgccaaagggcttaccgtgcccggaacttgctcagggaacagtggacccact
gctcatgtcactttcaatgttaatgctgaaacggtgttcggagagaatatctttgtgact
ggctccgttggcgctttggcaaactggtctcctgataacgcaattgctctcaatgcagat
aattatcccatttggagtgtggccattgacatcccagcaagcacgaatgtagaatataaa
tatattcgcaagttcaacggcggagttacctgggaatcggaccctaatagacggttcacg
tctccagcaagtgggagctctaccctcaatgatgtttggcgatag

DBGET integrated database retrieval system