KEGG   Agaricus bisporus var. bisporus H97: AGABI2DRAFT194216Help
Entry
AGABI2DRAFT194216 CDS       T03140                                 

Gene name
AGABI2DRAFT_194216
Definition
(RefSeq) hypothetical protein
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
abv  Agaricus bisporus var. bisporus H97
Pathway
abv04011  MAPK signaling pathway - yeast
abv04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:abv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    AGABI2DRAFT194216 (AGABI2DRAFT_194216)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    AGABI2DRAFT194216 (AGABI2DRAFT_194216)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:abv01001]
    AGABI2DRAFT194216 (AGABI2DRAFT_194216)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:abv03036]
    AGABI2DRAFT194216 (AGABI2DRAFT_194216)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:abv04147]
    AGABI2DRAFT194216 (AGABI2DRAFT_194216)
Enzymes [BR:abv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     AGABI2DRAFT194216 (AGABI2DRAFT_194216)
Protein kinases [BR:abv01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   AGABI2DRAFT194216 (AGABI2DRAFT_194216)
Chromosome and associated proteins [BR:abv03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     AGABI2DRAFT194216 (AGABI2DRAFT_194216)
Exosome [BR:abv04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AGABI2DRAFT194216 (AGABI2DRAFT_194216)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like RIO1 Kdo APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 18082754
NCBI-ProteinID: XP_006463375
JGI: Agabi_varbisH97_2_194216
LinkDB All DBs
Position
Unknown
AA seq 384 aa AA seqDB search
MPDTTSNQAQRQTRGHTHAASAAQPAPRKVRFNVGTQYQVLDVVGEGAYGIVCSAVHRPS
GRKVAIKKIAPFDHSMFCLRTLRELKLLKFLSESGVSENIISILDIIKPPSIEAFKEVYL
IQELMETDMHRVIRTQDLSDDHAQYFIYQTLRALKALHSADVIHRDLKPSNLLLNANCDL
KVCDFGLARSVKTAEPSGTETGFMTEYVATRWYRAPEIMLTFKQYTKAIDVWSVGCILAE
MLSGKPLFPGRDYHHQLTLILDVLGTPTLDEFYAITTRRSRDYIRALPFRKKKSFATIFP
NANPLAIDFLTKTLTFDPKKRITVEDALAHPYLEAYHDPDDEPVAPPLDPEFFDFDLHKD
DISREQLKELLYEEIMSFQPAPIV
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgccagatacgacctccaaccaagcccaacgccagaccaggggccacacacacgctgcc
tctgctgctcagcctgcgcctcgtaaagtcaggttcaacgttggtacccaataccaggtc
cttgatgtcgtgggtgaaggagcctacggtattgtctgttctgccgtacaccggcccagt
ggtcgcaaggttgccatcaagaagattgcgccgtttgatcactctatgttctgcttacgc
accttgcgggagcttaagcttctcaaattcctgagtgaatcaggcgtgagcgagaatatc
atttctatccttgatatcatcaagccgccctctatagaagccttcaaagaggtgtatttg
atccaggagttgatggagaccgacatgcatcgtgtcattcgaacacaggacctatcagat
gatcatgctcaatacttcatctaccagacgttgcgcgcactgaaagcgctccattcggca
gatgttattcatcgtgatctcaaaccgtcaaaccttctcctgaatgccaactgtgatttg
aaagtctgtgattttggtcttgccagatcagtcaaaaccgcggaaccctctggcacagaa
acgggcttcatgaccgaatacgttgcaacgcgctggtatcgggcacccgagattatgctt
acattcaaacaatacaccaaggccatcgacgtatggtctgtaggctgcattttagccgag
atgctctctggcaaacctctcttccccggacgggactaccaccaccaattgacgttgatc
ctcgacgtcttgggtacacccactttggatgagttctatgcgatcacgacacgtagatct
cgtgattatattcgcgctcttccattccgcaaaaagaaatcattcgctaccattttcccg
aatgccaacccattagcgatcgactttttaacgaagacattgacattcgatccgaagaaa
cgcattaccgttgaagatgcactagcgcacccatatttagaggcttatcatgatcctgat
gatgaacccgttgcacctcctcttgatcccgaattttttgactttgatttgcacaaagat
gatatcagcagggaacagttgaaagaacttctttatgaagaaatcatgtctttccaaccc
gcacccatcgtatga

DBGET integrated database retrieval system