KEGG   Agaricus bisporus var. bisporus H97: AGABI2DRAFT194802Help
Entry
AGABI2DRAFT194802 CDS       T03140                                 

Gene name
AGABI2DRAFT_194802
Definition
(RefSeq) hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
abv  Agaricus bisporus var. bisporus H97
Pathway
abv00010  Glycolysis / Gluconeogenesis
abv00051  Fructose and mannose metabolism
abv00052  Galactose metabolism
abv00500  Starch and sucrose metabolism
abv00520  Amino sugar and nucleotide sugar metabolism
abv01100  Metabolic pathways
abv01110  Biosynthesis of secondary metabolites
abv01130  Biosynthesis of antibiotics
abv01200  Carbon metabolism
Module
abv_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
abv_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:abv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AGABI2DRAFT194802 (AGABI2DRAFT_194802)
   00051 Fructose and mannose metabolism
    AGABI2DRAFT194802 (AGABI2DRAFT_194802)
   00052 Galactose metabolism
    AGABI2DRAFT194802 (AGABI2DRAFT_194802)
   00500 Starch and sucrose metabolism
    AGABI2DRAFT194802 (AGABI2DRAFT_194802)
   00520 Amino sugar and nucleotide sugar metabolism
    AGABI2DRAFT194802 (AGABI2DRAFT_194802)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    AGABI2DRAFT194802 (AGABI2DRAFT_194802)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:abv04131]
    AGABI2DRAFT194802 (AGABI2DRAFT_194802)
Enzymes [BR:abv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     AGABI2DRAFT194802 (AGABI2DRAFT_194802)
Membrane trafficking [BR:abv04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    AGABI2DRAFT194802 (AGABI2DRAFT_194802)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 18082997
NCBI-ProteinID: XP_006455144
JGI: Agabi_varbisH97_2_194802
LinkDB All DBs
Position
Unknown
AA seq 497 aa AA seqDB search
MVASRRGSGTLTLPSGQTLAYHTRTHDEEGLPHATKKTMADHLRRLESLFTLTPQRMRMI
VEAFKEALETGLEKNDQVVPMIPTYVFGWPTSKEQGDFLALDLGGTNLRVCLVTVQGNGQ
FELTQSKYRLTEEQKQDDGQKLFDFCAECLKTFIESNFSGENEVKAPAKLPLGFTFSYPC
SQAKIDHGVLIRWTKGFGAPNTEGNDVAAMFRKSLEKYQLPVTLTALINDTTGTLLASHY
VNPKTKIAVIFGTGCNAAYMERVENIPKISKLGIDPSSEMAINCEWGAFDSFEHEHLPRT
KYDTIVDESSNKPGEQAFEKLISGRYLGEILRLVICELIDDGVLFLGQNTYKLEVAYCFD
TAFLSLMESDPTDELLMIIGIFSHFFAVETTLAERQFFRALAKLIGKRAARLSACGIAAI
VSKMGYLDEGCLVGADGSLYNKYPGFPDRVHEGLVDIFGDKGRNILTCRAEDGSGVGSAI
IAAMTKVRKDAGIYPDL
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggttgcttcacgcaggggctccggaacgctcactttgccctccggccagactttggcc
taccacacaaggacccacgatgaggagggtctgccccacgcaacaaaaaagacaatggca
gatcacctccgtcgtctcgagagcctattcacgttgacccctcaaagaatgcggatgatc
gtcgaagctttcaaagaagcgctcgaaaccggtcttgagaaaaatgatcaggtcgttcca
atgatcccgacatatgtctttggatggccaacaagcaaggaacaaggtgactttctcgcg
ttagatctcgggggcaccaaccttcgtgtttgccttgtgactgtccaggggaatggacaa
ttcgaacttacccaatctaaataccgtttgacggaggagcaaaagcaggacgacgggcaa
aaactgtttgacttctgcgccgagtgtctcaagacgttcatcgaaagcaacttcagcgga
gaaaacgaggtcaaagcacctgcaaaactcccccttggctttaccttttcatacccctgc
tcgcaagcaaagatcgatcatggtgttcttatccgctggaccaaaggtttcggtgcccca
aatacggaaggtaacgatgtcgccgcgatgtttcgcaagtctctagaaaaataccaactc
ccagtgacgctcactgccctcatcaatgacacaactggaacgctgctcgcatcacattac
gtgaacccaaaaaccaaaatcgctgtcatctttgggacggggtgcaatgcagcatatatg
gagcgtgtcgaaaacattcccaagatttcaaaactaggaatagacccatcttcggagatg
gcaattaactgtgaatggggcgcttttgactcgttcgagcatgagcatctaccaaggacc
aaatatgatacgatcgtagacgaatcttctaacaaacccggggaacaggcttttgaaaaa
cttatctctggccgttatttgggcgagattctcagattggtcatatgtgaactcatagac
gatggtgttctgttcctcggtcagaacacatacaaactggaggttgcgtattgtttcgac
actgccttcttgtcattgatggaaagtgacccaacggacgaattgcttatgatcattggc
atcttctcacatttcttcgctgtcgagactacccttgcggaacgccaattcttccgtgcg
ctggcaaaactcattggtaaacgtgctgcgcgcttgagcgcttgtggtattgctgccatc
gttagcaagatgggatacttggatgaaggatgcttggttggcgctgatggcagtttgtat
aacaaatatcctggattcccggatagagtgcatgaaggtcttgtggatattttcggtgat
aaaggacggaacatcttaacgtgccgtgcagaagatggaagtggagtgggtagcgctatc
atcgcagccatgaccaaagttaggaaagatgctgggatctatcccgatctttaa

DBGET integrated database retrieval system