KEGG   Agaricus bisporus var. bisporus H97: AGABI2DRAFT195434Help
Entry
AGABI2DRAFT195434 CDS       T03140                                 

Gene name
SDH2, AGABI2DRAFT_195434
Definition
(RefSeq) succinate dehydrogenase iron-sulfur subunit
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
abv  Agaricus bisporus var. bisporus H97
Pathway
abv00020  Citrate cycle (TCA cycle)
abv00190  Oxidative phosphorylation
abv01100  Metabolic pathways
abv01110  Biosynthesis of secondary metabolites
abv01130  Biosynthesis of antibiotics
abv01200  Carbon metabolism
Module
abv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
abv_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:abv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AGABI2DRAFT195434 (SDH2)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AGABI2DRAFT195434 (SDH2)
Enzymes [BR:abv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AGABI2DRAFT195434 (SDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer2
Motif
Other DBs
NCBI-GeneID: 18083236
NCBI-ProteinID: XP_006456222
JGI: Agabi_varbisH97_2_195434
LinkDB All DBs
Position
Unknown
AA seq 267 aa AA seqDB search
MLSASSRSAFTRANHLTRSFATTARAAQAVQKPVLEKEFKIYRWNPDEPSKKPTLQSYKI
DLNQCGPMILDALIKIKNEMDPTLTFRRSCREGICGSCAMNIDGQNTLACLCRIDREGSK
DTKVYPLPHMYVVKDLVPDLTLFYKQYKSIQPWLQNDNPPAHEHLQSIEDRKKLDGLYEC
ILCACCSTSCPSYWWNQDEYLGPATLMQAYRWIADSRDTHGAQRKEVLQNEMSLYRCHTI
FNCSRTCPKGLNPAAAIAKIKLELATD
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgctctccgcaagctcacgctcggccttcacccgtgccaaccacctgactcgctccttt
gccaccaccgctcgtgctgcccaggcagttcaaaagccagttctcgagaaagagttcaag
atttaccgttggaatcctgatgaaccttccaagaaacccactctgcagtcttacaaaatt
gacttgaaccaatgtggacctatgattctggatgcacttatcaagatcaagaatgaaatg
gatcctacactgactttccgacgttcatgtcgagagggcatttgtgggtcatgcgctatg
aatattgacggccagaacactctggcctgtttatgccgcattgacagggaaggtagcaag
gacaccaaggtctaccctcttccccacatgtatgttgtgaaggacctcgtaccagacctg
acgctgttctacaaacaatacaagtctatccagccttggctacagaacgacaacccccct
gcacacgagcacctccagtccatcgaagaccgcaagaagttggatggtctgtatgagtgt
attctctgcgcttgttgctcgacctcttgcccttcatactggtggaaccaggatgaatat
ctcggccctgcgactctcatgcaagcgtacaggtggattgcagattcccgagacactcat
ggtgctcaacgcaaagaggttttgcagaatgaaatgagcttgtaccgatgccacaccatc
ttcaactgctcccgtacttgcccgaagggtcttaaccccgctgctgccatcgccaagatc
aagctcgagcttgccactgactag

DBGET integrated database retrieval system