KEGG   Agaricus bisporus var. bisporus H97: AGABI2DRAFT205907Help
Entry
AGABI2DRAFT205907 CDS       T03140                                 

Gene name
AGABI2DRAFT_205907
Definition
(RefSeq) hypothetical protein
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
abv  Agaricus bisporus var. bisporus H97
Pathway
abv03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:abv00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    AGABI2DRAFT205907 (AGABI2DRAFT_205907)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:abv01001]
    AGABI2DRAFT205907 (AGABI2DRAFT_205907)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:abv03032]
    AGABI2DRAFT205907 (AGABI2DRAFT_205907)
   03400 DNA repair and recombination proteins [BR:abv03400]
    AGABI2DRAFT205907 (AGABI2DRAFT_205907)
Enzymes [BR:abv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AGABI2DRAFT205907 (AGABI2DRAFT_205907)
Protein kinases [BR:abv01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   AGABI2DRAFT205907 (AGABI2DRAFT_205907)
DNA replication proteins [BR:abv03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     AGABI2DRAFT205907 (AGABI2DRAFT_205907)
DNA repair and recombination proteins [BR:abv03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    AGABI2DRAFT205907 (AGABI2DRAFT_205907)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase TAN FATC
Motif
Other DBs
NCBI-GeneID: 18084196
NCBI-ProteinID: XP_006461899
JGI: Agabi_varbisH97_2_205907
LinkDB All DBs
Position
Unknown
AA seq 2974 aa AA seqDB search
MSNLKEILYKLKSSKITERQEGLAGIETAFSKTSFLRTFHLTETNDKTEKRSWKIVFDAL
AVMINLEKIEYSRTVDKGKPPKPTVVKRLTDAARTIRMLVEKAVTFFGKTDMQVLVGHLY
GGIFLRNGLMTPIALDYAKALKCILSFRPHLEHLRDDTWEDLVALGFNVVLGESSRGQLD
QDIDSAVESGEETSNDKGELEEEEDGDELPVVKGKRKRETSRSGLSQMSASVSKPRRREA
KAASVSLEQVEFASILYILLGYSGAPILASDRSYLPRSILNRLERFLTLYPADSSLLYDY
LPTLSSVLDHLALNHVKDTQRFARNTWDTLIGLWNTKDKSLREHLIVVIRAIMPYLTADF
GLKSFRDPYDQAGALWKLYNTLEGEADNRRGVETLALDSLRLEIYTGAAHEGMMEAFTAH
TFRAGFNFDTRQAISWAILQTQADCVAKLYELSESMNSGATPVPLRGEKKRKLDNGISSI
LSGIQTGLSQHARIFNLQVLLFLIDRNWLSIHLTLKHHIIDSLLQLVALEDTSIQTWTLL
CLAAIVYAERFLAKVKDVTLPSQSLESQSQAGFETGTWDSVWTHSIRRINSPPTCRAASH
TAYTLIYQAVGSLTISLPSQRILSEIEILSSDLEVQGPAYPYDSVCNFLAQCVNLAGQDA
RLYRIHLEDKVVGWIIDHWKVTATAKIRSMPPTLQDGVSLLEAICGFSRKSHLISRAMLP
SCDVATALQREISEERVRDFLLSAQLPMPHSRSHLKIQDTTTPTTAEVDVGTNANDLSPP
QARERKISAFFLRSIELLTTEWEGIVENHTNVTADAAQQSLEHALTSLVFESLLVYNGVA
SNRHLIQASAKMLSTILPLLNSTTWNYVEKATVLSALEPLILLENMDNSPWEVVLPPGTS
SGIKRRMLNEIMDTSEDPTKQLKAARTNLLRILWRMPDAQNCLQNVVKVLRQLFCDMIAS
SDPAAMDNMGTETDERDGFGPVRDVAGRTGPPQFGIPEADPFILRTMEICLRFVVNGPLL
HSLSGEPTKDTEVIDAVLACDVDNPKGFLVGFPLLLSNVQRGTFSLGSNLNPSLKVLEEI
LTSYKYRRSERLLQITFQLLSAILQSWFSSADVRKEVDELLDFLLNRHLSKQARYRSERD
AFIRFVEQRVLSRFLALGNIIVASSCVRRGPYWHLIETCLFADQYSSHIEAILMSVSHCL
GLTPSLLFEAYASQIGYSMIKSEGDISRIPPHLIGFEDRRQSAAFALSAFAPTYITSLNG
SPFETHCKLVGVTPEDTYANGFGDIVGAVATDWFKMHPSPDIVQLEKLLQGNSYSRNFDQ
DLRNNADGVALAIIRSLSDQVLSPAGAIQQALQARSNRIAQTFTELVKYRPMDSHVSHES
NLPAFEISIVLPTLSWLLGKVKDESKKSMTYHVLHGLFAAIYASPVVNEQIRLVNALSVW
TALRCEDFDDPTLLHTLVQGSTALLAEYDLAHAAQSMLEWAFRSYRKLKLKDSAFSNIII
RVCSIAYDYARSQYPDFQKLGNVLMDWMDRQAIVLSKSAVQIQVIRALPTWPYVPVPELA
QIAAEQSSEGLEALLDDSRITYNKFRLVRRLYDHISQGGRLKARFCKHDFWRLKDCIPAQ
TELQQDDADAFASLLILGHGDVSGITRDYQSHRSILTRCRPSKHNVDFNDPNLNNEIIIY
SLLQLLDSHSAKSVFSAYETLRRIMAVLDNFAIPNGPSDYNSELEHLRAFPRRARTRSSC
KLDEVVAPDTLLELTVDFNRWISILSSRLSDYLARYSPTYAQLSSVLLANAEFAADLLPI
LVHSILRTEIQKDKYVSKDRRRILTDYFTSVLNFEQASTACRQSIIDIVLHLREFLPQKE
AALSYNEWLDVDFMLLAKNAVACGAYTTALLFLELSLDHSSAKPQRANKQEDLLYEIYSH
IDEPDGFYGIKPSDLQRFLIRRFHHEKQWDKALQFHGATVEADPNHFAGSDGLLQAFSSF
GFNHLVMNTLRTPGSSSSAMDYRRGWRTETWDLPESKVFITGSSLYSSLRALYRERNPHI
IDSITQQAISRTMNRLRSLGSENMTEIREIVQELMCLKEVKDWRDDISQLKFRNDNIKAD
DWSNLFDIDAHFDFSDLELLMETRISLLHSARQKEERQQIGTLVTPLCSVLKEIEKRCLL
RLSRAARDENHVQIALNSIMRAQRLCNDSSIDVAEEYASVLWELKEQGAAIQYLQNIIRP
LNKRQECDTQQAIYHVLLKARLGSWIATACLESPTAIWEKYLQKAVNDLETNNVIDAVSS
KSRATVYHDCALFAERQYYLTLKSPDGIRWKVYVERKTQEVQHWNTQLAAAGDQRSREDF
RGRQLTAQKVLKQDSEQFRKHLASRDQFLKQALEMYAKSLEVADTYDDDASIRFCSLWFA
NFESEGDLQDTIDIALSRIPSYKMVFLAHQLTARLSWPTGELPQCQRSLQKMILRMCKEH
PFHSLYQVYCLLPERNISDFSRRQSGRLVAQTMPSTQTERGSAAQVVFDKLRADTAVQDK
VAEVEKLCNASWQWAKFPVGKGTKYARLNYLYQIPPELLICRLPALRVPVPTFPLPLDPT
MRYDNCISIDSFEKQFQLVGGINLPKFCSCKASNGKTYKQLFKGGNDDLRQDAVMEQVFD
VVNGVLQRDRQTKRRELGVRGYKVIPLDSQTGLLEFVTNTTPLRGWLNAGHKRYRPTDMG
ADEVKHRHDKAWNIYLGDADRDKLLKVYYETRSKVKPVMRHYFTEKSKSPVTWFAMRLKY
TRSVATTSIVGHILGLGDRHTSNILLDNSTGEVVHIDLGIAFDQGKLLRVPETVPFRMTP
NMIDGMGSSGTTGVFQRCAEETLRVLRDGSDVIMTVLEVFKHDPLHSWTLSDTKYQNAQR
HDQQQTVATTSNSDLQRHALGMDIGIDITSGGVEEAADRALSSVARKLDKSLSVEYTVNQ
LIAEATEPFNLASIYHGEFFSFLLSKKKKNSELM
NT seq 8925 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacctgaaggagatactctacaagctaaagagctccaagatcactgaacgtcaa
gaaggactggctgggattgaaactgccttttcgaaaacctcgttcctgcgcacatttcat
ctcacagaaaccaatgacaagactgaaaagcgtagttggaagatcgtgttcgatgcatta
gcagtgatgattaatttggagaaaatcgaatattcgaggactgtggataaagggaagcca
ccgaaacccactgttgtgaagcgccttacggatgctgcaagaacgataagaatgttggtg
gaaaaagctgtaacgtttttcgggaagacggatatgcaagttctggtggggcatttgtat
ggggggatttttctcaggaacggattgatgacacccattgctttggattatgccaaagca
ttaaagtgtatactcagtttcagaccgcatttggagcatctcagagatgatacatgggaa
gaccttgtggctctaggtttcaatgtcgtgttgggagaatcatccaggggacaattggat
caagatatcgattcggctgttgaatctggtgaagaaacatcgaatgacaagggggagtta
gaagaggaggaggatggagacgagcttcctgttgtgaaagggaaaagaaagcgggaaacg
tctcgttctgggctaagtcaaatgtccgcttccgtatccaaaccgagacgccgagaagcc
aaagcagcatctgtttcccttgaacaagtagaattcgcgtcaattctctacatcttgttg
ggctattctggcgcaccgatacttgcctcggacagatcctacctaccgcgaagcatactc
aaccgcttggaacgtttcttgacgctttatccggcagattcctcgttgctctatgattac
cttccaacactttcttcggttcttgatcatcttgcactgaatcatgtgaaggatacgcaa
agattcgctcgtaatacgtgggacactcttattgggctttggaacacgaaagacaagagc
ttaagggagcatctcattgtggtcattcgcgcgataatgccctacttgactgcggatttt
ggcctcaaatctttccgcgacccttacgatcaagcaggagcgctgtggaaactctataac
acactggaaggagaggctgataatcgtcggggtgttgaaactcttgcattagactcattg
cgtctcgagatatacactggtgcagctcatgaagggatgatggaggcctttaccgcccat
actttccgtgctggatttaacttcgatacgcgtcaagcaatttcctgggcaatattgcaa
acacaggcagattgtgttgccaaattatacgaactctccgagtccatgaatagcggcgca
actcccgttcctctcagaggcgaaaagaagcgcaaattagacaatggcatatcctctatc
ctatctggcatccaaacgggattgtctcagcacgctcgaatcttcaacctccaagttctc
ctttttcttattgatcgaaattggctgtcaatacaccttacacttaagcatcatatcatc
gactcgctattgcagctcgtggcattagaggatacttccatccaaacctggactcttcta
tgcttggccgcaattgtatatgcggagagattcttggccaaagtgaaagatgtgacattg
ccctctcagtcgcttgaatcacagtcgcaggcgggatttgaaacggggacttgggattcg
gtctggactcattctatccgacggatcaactcacctcccacttgtcgtgcggcttctcac
actgcatacacccttatttaccaagccgtaggaagcctcacgatatctctcccatctcaa
cgtattctttccgagatagagattctatcttcagatctggaggttcaaggccctgcttat
ccatatgattctgtatgcaattttctcgctcagtgtgtcaatcttgcaggtcaagatgct
cgcctgtaccgcatacatctggaagataaagtcgttggttggattatcgatcactggaag
gtaacagcgacagctaagatcagaagtatgccaccaacattacaggacggtgttagccta
ttggaggcgatttgtggattttcacggaaaagtcacctcatttcaagagcaatgctccct
tcatgcgatgttgcgacggcgctacagagggagatatctgaagaaagagttagagacttc
cttctatccgctcagctgcccatgccgcatagtcgatcccatctcaagatacaggacacc
acgacacccactaccgccgaggttgacgttgggaccaatgcaaacgacctatcccctcct
caagctcgtgaacgcaaaatttcagcgttcttccttcgcagcattgaactattgactact
gaatgggaaggcattgtcgagaatcataccaacgtgactgccgacgccgctcagcagtct
ctagagcacgctctcacttctcttgttttcgagtcgttgctcgtttacaacggcgtagct
tccaatcgacatctcatacaagcatctgcaaaaatgctctcgaccattttaccacttttg
aatagtacaacatggaattacgtcgaaaaagccactgtactgagtgctctagaaccttta
attctgctcgagaatatggataattccccgtgggaagttgtgctgcctccaggaacgagt
tctggaatcaaaaggcgcatgttgaacgagattatggatacttcagaagacccaacaaag
cagctcaaggctgcgaggaccaacctactgcggattctttggcggatgccagatgcccaa
aactgcctccaaaatgttgtgaaagtgttgcgccagctattctgtgatatgattgcctcg
agtgacccagctgcaatggataacatgggtaccgagaccgatgaacgcgatggttttggc
ccggtcagagacgttgctggtcggaccggtcctccccaatttggaatcccggaagcagac
cccttcatattgcgtaccatggaaatctgtctgcgttttgtggtcaacggtccgcttctt
cactctctatctggggagcccaccaaggacacagaggtcattgatgcagtcctggcctgt
gatgtcgacaatccaaagggatttcttgttggcttccccctcctcctatccaacgttcag
cgtggcacctttagtcttggtagcaatctgaaccccagcctgaaggtattggaagaaatt
ctcacctcctacaagtaccgaagaagtgaacggctgctgcaaataacttttcaacttctt
agtgcaattctgcagtcatggttcagtagcgctgacgtcagaaaggaagtagacgagcta
ttagatttcttactgaaccgacatttgagcaaacaagcaagatataggtccgaacgagat
gctttcattcgctttgtcgagcaacgcgttctttcgcggtttttggctttgggaaacatc
attgttgccagctcctgcgttcgccgtggtccttactggcatttgatcgagacttgcttg
tttgctgatcagtattcttcccacatagaagccattctgatgtcggtatctcattgcctg
ggtctgacgccctcgctcctttttgaagcttatgcttcacaaataggatattcaatgata
aaatccgagggtgatatatcgcgaatacctccccacctcattggcttcgaagaccgaagg
caatccgctgcgtttgccttgtctgcatttgctcccacctatatcacaagtttgaacggg
tccccctttgaaacccactgcaaactagtcggtgtgacacctgaagatacttacgccaac
ggctttggcgatattgtcggtgctgtagcaaccgattggttcaaaatgcatccgagcccg
gacattgttcagctagagaagcttttacaaggcaactcttatagccgtaacttcgaccaa
gatctgcgaaacaatgctgacggtgtcgccctcgccattattcgttctctttcggaccag
gttctctctcctgcaggagcgatccagcaagcgcttcaggcacgctcaaataggattgca
caaactttcaccgaattagtcaagtatcgcccaatggattcacacgtatcacatgagtct
aatctccctgcgttcgaaatttctatcgtgcttcctacactctcctggctcctcggaaaa
gtcaaagatgagtcaaagaaatccatgacgtaccacgtccttcatggacttttcgccgcc
atttatgcttctcctgtagtgaatgagcagatacgccttgtcaatgcactctctgtttgg
actgcactccgctgtgaagatttcgatgaccccacattacttcacactcttgtccaaggt
tccactgctcttttggctgagtatgacttggcacatgctgctcagtccatgctcgaatgg
gcattccgttcctaccgcaagctcaaattaaaggattcagcattctccaatatcatcatc
cgcgtctgtagcatcgcctatgattatgctcgatcgcagtatcctgacttccaaaaactg
ggtaacgttctcatggattggatggatagacaagcaatcgtcctgtccaaatctgctgtc
caaatacaggtcatccgtgctttaccgacttggccatatgtccccgtcccagaattggca
caaattgctgcagagcaatcctcagaagggttggaggcccttttagacgactcgaggatt
acctataacaaattccggttggttcgacgcctttatgatcatatatcacaaggaggcagg
ctcaaggcccgattttgtaaacacgatttctggcgcttgaaggattgcattcctgctcag
acagagctacagcaggacgatgcagatgccttcgcctccctgctgattcttggccatggg
gatgtcagtggtatcacgcgtgactatcaatctcacaggtcaatcctcactcgttgtcgt
ccttcaaaacacaacgtggatttcaatgatccaaatttaaacaatgaaatcatcatctat
tccttgttacagcttcttgatagccattctgcgaaaagtgttttttccgcctatgaaact
cttcggcggataatggcagttctagataactttgccattccaaatggtccaagcgactat
aatagcgaacttgagcacctgcgtgcatttcctcggcgcgctcggactcgctcatcctgc
aaactagatgaagttgttgcaccagacactcttctagaactcactgttgacttcaaccgt
tggatatccatcctaagcagcagactcagtgactatctagctcgctacagcccgacatac
gctcaactctcttccgttcttctcgccaacgctgagtttgctgctgatctactaccgatt
ctggttcattccattctgcgaacagaaatacaaaaggataaatatgtgtccaaggaccgt
cgccgcatcctcaccgattactttacgtccgtcctgaatttcgaacaagcgagcaccgca
tgccgacaatctataatcgacattgtccttcacctccgggaatttcttccccagaaggaa
gctgctctgtcatacaatgaatggttggatgttgatttcatgctactcgcgaagaacgca
gtcgcttgtggggcatacactacagcacttctttttctagagctaagcttggaccattcg
tcggcaaaaccccagagagcaaacaagcaagaagacctactttatgagatttattcacat
atcgacgaaccagatggtttttatggaatcaagccgagtgacttacaacggtttcttatc
cgtagattccaccatgagaaacaatgggacaaagctttacagtttcatggagcaactgtc
gaggcagatccgaatcacttcgctggatcagatggcctcttacaggcgttcagttcattc
ggctttaatcatcttgttatgaatacccttcgcacaccggggtcaagcagctccgccatg
gattaccgacgaggttggagaactgaaacatgggacttacctgaaagcaaggtgtttatc
acaggttcatctctctattcttctcttcgagcattatatcgcgagcgtaatcctcacatc
attgactccatcactcaacaagctatttcgcgaacaatgaaccgacttagaagtttggga
tcagaaaacatgacagaaattcgcgaaattgtccaagagctgatgtgtctaaaggaggtg
aaggattggagggacgatatttcccaacttaagtttcgcaacgacaacatcaaggctgac
gattggtccaaccttttcgatatcgatgctcacttcgacttttccgatttggaattacta
atggaaacccgcatatccctcctacactctgcccggcaaaaagaagagcgacagcaaatt
ggcaccttggttacacctctttgttctgtgctaaaagagatcgaaaaaagatgtctttta
cgcctgtcccgggctgctcgggatgagaaccatgtccagattgcgttaaactcgattatg
cgtgctcagcggctatgcaacgactcttcgatcgacgttgctgaagaatatgcgagcgta
ctatgggaactgaaagaacaaggggcggctatccagtaccttcaaaatatcattcggcct
ctaaacaaaaggcaggagtgcgatacgcaacaggctatatatcacgtccttctcaaggct
cggctgggatcttggatagcgacagcatgtttggagagtcccacggccatatgggaaaag
taccttcaaaaagcggtcaatgatttagagacgaataatgtgattgatgctgtatcttcc
aagagccgtgcgacagtttaccacgactgtgctctgtttgctgaacggcaatactattta
actctcaaatcgccagacggaatacgatggaaagtctatgtcgaaagaaaaacgcaagaa
gttcaacattggaatacacaactagcagcagcaggggatcagcgatcaagggaagatttt
cggggacggcaacttactgctcagaaggttcttaaacaagatagcgaacagttccggaaa
cacttggccagtcgtgatcagttcttgaaacaggcgttggagatgtatgcaaaatctctg
gaggtcgcggacacgtacgacgatgatgcttcgatcagattctgctcgttatggttcgct
aatttcgagagcgaaggagaccttcaggacacgattgatatcgccctttcccgtatccca
tcctataagatggtattccttgcccatcaactcaccgccagactttcctggccgacggga
gaactaccacaatgccagcgaagcctacaaaaaatgatcttgcgcatgtgtaaagagcat
ccgtttcacagcttgtatcaggtatactgtttgcttccggaacgaaatatttccgacttc
tcgaggcgacagtctggtcgcctagtggcgcagacgatgccatctactcaaacggagcgt
ggatctgcggctcaggtcgtcttcgacaagctccgcgctgatactgcagtccaggacaag
gttgctgaagttgaaaaactctgtaatgccagctggcaatgggcaaagtttcctgtggga
aagggtactaaatacgctcgcctgaattatctataccaaattccccccgagctcctgatt
tgtcgcctacctgctctccgagtacctgtacccactttccccctccctttggatccgacc
atgcgctatgataactgtatttctattgacagttttgaaaagcagttccaactagtaggt
ggtataaatctaccgaaattttgttcctgtaaagcgtccaatggcaaaacctacaaacaa
ctgttcaagggcggcaacgatgacttgcggcaggatgcagttatggagcaagttttcgac
gtcgtcaatggcgtgttgcaacgtgacaggcagaccaagcgtcgtgagctcggcgtcagg
ggatacaaagtcatacccttggacagtcaaaccggtcttctggaattcgttaccaacacc
acgccgttgcgcggctggctgaacgcaggacacaaacgctaccgaccaacggatatgggc
gccgacgaggtgaagcaccgtcacgataaagcttggaacatttacctgggggatgcggac
cgagacaagctattgaaagtgtattatgagacccgcagcaaagttaagcccgtcatgcgg
cattactttacagaaaagagcaagtcgcctgtgacatggttcgcgatgagattgaaatac
accagaagcgtcgctacgacttcgatcgttggtcatatccttggccttggcgataggcat
acatccaatattctactggacaatagtaccggagaggttgtgcatattgatttaggtatc
gcctttgaccagggtaaacttctacgtgtacctgaaactgtgccgtttcgcatgacccca
aacatgattgatggaatggggagttccggtacgacaggggtctttcaacgatgcgcagaa
gagacattacgggttcttcgtgatggatcggacgtgataatgactgttctcgaagtgttc
aaacatgatcctttacattcctggactttgagtgataccaagtaccaaaatgctcaacgg
catgaccaacaacaaacagtggccacgacttcgaacagtgatctacaacgacacgctctt
gggatggatattggtattgatataactagtggaggtgtggaagaagcagccgatcgggcc
ttatcctccgtcgcgcgtaaactcgacaaatcattgagtgtggagtataccgtgaaccag
cttatcgcagaggctactgaaccctttaacctcgcttcgatctatcatggtgagttcttt
tcctttttattatcgaaaaagaagaaaaatagtgaactgatgtga

DBGET integrated database retrieval system