KEGG   Agaricus bisporus var. bisporus H97: AGABI2DRAFT212044Help
Entry
AGABI2DRAFT212044 CDS       T03140                                 

Gene name
AGABI2DRAFT_212044
Definition
(RefSeq) hypothetical protein
Organism
abv  Agaricus bisporus var. bisporus H97
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 Glutaredoxin GST_C_5 IFRD
Motif
Other DBs
NCBI-GeneID: 18084658
NCBI-ProteinID: XP_006456867
JGI: Agabi_varbisH97_2_212044
LinkDB All DBs
Position
Unknown
AA seq 294 aa AA seqDB search
MPENTKQDKGRAYHTKCTGAALSTVARQDKDEDITLFGSCFCPFVQRVWIAFEYLGVPYK
AYEVDPYKKPQELLEVSPKGLVPGLRFNNYNPPRALNESTVILEYLEDLASGTTRRSLLP
PTTNPYARALVKLQSDHVNRNLVPAFYRFLQAQDTEVQITAGKELHQVIETLVGLLERAE
REIIGGGGISGDGERQALSKGLGLWIEGGDVGWTDVMVAPWLYRARLVLKHYRGFELPQG
DKFNAWLDRLFTHLAVVATCSTDDLYLDSYERYAFNRPNTSQVANAINSGRGLP
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagaatacaaaacaagacaaaggcagagcttaccacacgaaatgcactggtgca
gccctcagcaccgttgctcgccaagacaaagatgaagacattacgttgttcgggagttgc
ttttgtccattcgtgcaacgtgtatggatcgctttcgaatacttgggagtgccgtacaag
gcatatgaagttgatccatataaaaagccccaggaacttttagaagtttccccaaagggc
cttgttccggggctgaggttcaacaattacaatccgcctagggcgttgaatgaaagtaca
gttatattggagtatctcgaagacttggcgtctggtactactcgaagatcacttcttcca
cccaccaccaatccttatgccagggctttagtcaagcttcaaagcgatcatgttaatcgc
aacctggttccagcattttataggttccttcaagcccaagatacagaagtccaaattacc
gcaggtaaagaacttcatcaggtcatcgaaactctcgtcggtcttctggagagagccgaa
agagaaataatcggtgggggtgggatttctggtgatggggaacgtcaggctttgagtaaa
ggccttggtctatggattgaaggtggagatgtgggttggacagatgtgatggttgctcct
tggctttacagggcgcgactggtattgaagcattatagaggatttgagcttcctcaagga
gataagttcaacgcttggttggatcgtctgttcacacacctggcggtcgtcgccacttgc
agtactgatgatctctacctggatagttatgagaggtatgctttcaatcgtccgaacact
agtcaagtggcgaacgccatcaacagtggaagaggactgccttaa

DBGET integrated database retrieval system