KEGG   Agaricus bisporus var. bisporus H97: AGABI2DRAFT64256Help
Entry
AGABI2DRAFT64256  CDS       T03140                                 

Gene name
AGABI2DRAFT_64256
Definition
(RefSeq) hypothetical protein
Organism
abv  Agaricus bisporus var. bisporus H97
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo
Motif
Other DBs
NCBI-GeneID: 18086027
NCBI-ProteinID: XP_006458278
JGI: Agabi_varbisH97_2_64256
LinkDB All DBs
Position
Unknown
AA seq 364 aa AA seqDB search
MHVDTRPSGEEPQPPLRLLQDEPLRLYPTGPSGIRLSDFEVRGTLGTGTFGHVLLVRHKT
ARSDSTQLYAMKVLRKTKIVALHQIEHVKAENYILGRVQHPFVVDLFATFQDGLNIYMLM
SYIPGGELFTHLRRAQRFSPDVTRFYLSTIVLALRYLHSYNIVYRDLKPENLLLDARGYI
RLTDFGFAKVVDDRTWTLCGTPEYLAPEVIQSDGHGKAADWWACGVLCYEMLVGYPPFFD
ETPYGIYEKILVGEVYWPRHLDRLSKDLIRGFLNPDRSKRLGNAGDGIEGVLRHAWFRGV
DWEALERREINAPIIPRSSGEEEAENFLNLPVPAAQDIPGFFQDDATIAAQIRNDYLSYH
FPTF
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtagacacccgaccctccggagaagagccccagccaccgcttcgattattacag
gatgaacctttgcgcctatatcccaccggtcctagcggtattcgattgtcagactttgaa
gtccgtggcaccttgggaacagggacgtttggccatgtgctacttgtcaggcataaaacg
gcccgatcggactcgactcaactctacgcaatgaaggttcttcgtaagacgaagatcgta
gcacttcatcagattgaacatgttaaagcggaaaactatatcctgggccgcgttcagcac
cccttcgtcgttgacctctttgcaacctttcaagatggtctcaacatttacatgctgatg
tcatatatacctggtggcgagcttttcacccaccttagacgtgcacaaagattcagtcct
gatgtaactcggttttatctctcgacgatagtcctggcactgcgatatctccattcctac
aacatcgtttatcgtgatcttaaaccagaaaaccttctcctcgacgctcgcggctatatt
cgccttactgactttggattcgcaaaagtagtggatgatcgtacctggactctttgtgga
actcctgaataccttgcgcctgaagtgatacaatcagatgggcacggaaaagcagctgat
tggtgggcctgcggtgttctttgctatgagatgcttgtcggctatcctcctttcttcgat
gaaactccatatggcatatatgaaaagatccttgttggcgaggtctattggcctcgtcac
ttagatcgtctatctaaggatctgatccgaggcttcctcaatcctgataggagtaaacgt
ttaggaaatgcgggcgatggcatcgaaggcgttcttcgacacgcgtggttccgtggtgtc
gattgggaggcgctagaacgacgtgaaataaatgctccaataattcctcgttcatcaggc
gaagaggaagcagaaaacttcctcaacctgcctgtccctgctgcacaggatatccccggt
ttcttccaagacgacgctactattgctgcacaaattcgcaacgattatctttcctatcac
ttcccaacattctaa

DBGET integrated database retrieval system