KEGG   Acinetobacter baumannii AC29: BL01_05100Help
Entry
BL01_05100        CDS       T03377                                 

Definition
(GenBank) fumarate reductase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
abw  Acinetobacter baumannii AC29
Pathway
abw00020  Citrate cycle (TCA cycle)
abw00190  Oxidative phosphorylation
abw00650  Butanoate metabolism
abw01100  Metabolic pathways
abw01110  Biosynthesis of secondary metabolites
abw01120  Microbial metabolism in diverse environments
abw01130  Biosynthesis of antibiotics
abw01200  Carbon metabolism
Module
abw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
abw_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:abw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BL01_05100
   00650 Butanoate metabolism
    BL01_05100
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BL01_05100
Enzymes [BR:abw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BL01_05100
    1.3.5.4  fumarate reductase (quinol)
     BL01_05100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO Thi4 Pyr_redox_2 GIDA HI0933_like FAD_binding_3 NAD_binding_8 Pyr_redox_3 NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AIA51196
UniProt: V5VBX8
LinkDB All DBs
Position
complement(1059017..1060852)
Genome map
AA seq 611 aa AA seqDB search
MGAINPKEDYSNIQNLTFDAVIVGGGGSGMRASYQLAQAGLKVAVLTKVFPTRSHTVAAQ
GGIGASLGNMQEDNWHFHFYDTVKGSDWLGDQDAIEFMCREAPKVVYELEHLGMPFDRNA
DGTIYQRPFGGHSANYGDKPVPRACAAADRTGHALLHTLYQSNVKMGTQFFVEWIALDLI
RNEAGDVLGVTAIDQETGNIAVFQAKATLFATGGAGRVYRASTNAYINTGDGLGMAARAG
IPLQDMEFWQFHPTGVAGAGVLLTEGCRGEGAILRNKDGEPFMERYAPTLKDLAPRDFVS
RSMDQEIKEGRGCGPKGDYILLDMTHLGADTIMKRLPSVFEIGKKFANVDITKEPIPVVP
TIHYQMGGIPTNMHGQVCLPEPGTDNYTKPVKGFYAIGECSCVSVHGANRLGTNSLLDLV
VFGKAAGEHIIDYVTKHHGDEYAPLPTNVLEQTLARVRKLDESTSGENAQEVADAIRDIV
QDHAGVFRTQALLDKGVKEILALEPRVRNIHLKDKSKVFNTARVEALEVENLYEVAKATL
ISAAARKECRGAHTVVDYELPADHPTYSYGRRDDEWMKHTLWYSSDNRLEYKPVRFKPLT
VDPIPPAPRTF
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcgataaaccctaaagaagattattcaaatattcaaaacctcactttcgatgct
gttatcgttggtggtggtggttctggtatgcgtgcatcttaccaacttgctcaagcaggt
ttgaaagttgcagtacttactaaagttttcccaacacgttcacatacagttgctgctcag
ggcggtattggtgcgtcgttaggtaacatgcaagaagataactggcatttccacttttac
gatacagtaaaaggttctgactggttaggtgaccaagacgcaatcgagtttatgtgtcgt
gaggcgccaaaagttgtttatgaacttgaacacttaggtatgccgtttgaccgtaacgct
gatggtacaatttaccaacgtccattcggtggtcactctgcaaactatggtgataaacca
gttccacgtgcttgtgctgctgctgaccgtactggtcacgctttattgcacacgctttat
caaagcaacgtgaaaatgggtactcaattcttcgttgagtggatcgctcttgatttgatc
cgtaacgaagcaggtgatgtactcggtgtaactgcaattgaccaagaaactggtaacatt
gcagtattccaagcaaaagcaacattatttgcaactggtggtgctggtcgtgtttaccgt
gcatcaacaaatgcttatatcaacactggtgacggtcttggtatggctgctcgtgctggt
attccattacaagatatggaattctggcaattccaccctacaggtgttgcgggcgcaggc
gtattgttgactgaaggttgtcgtggtgaaggtgcgatccttcgtaacaaagacggcgaa
ccattcatggaacgttatgcaccaactttaaaagacttggctccgcgtgacttcgtatca
cgttctatggaccaagaaattaaagaaggtcgtggttgtggtccaaaaggtgattatatc
ttgcttgatatgactcacttgggtgctgacacaattatgaagcgtttaccatctgtattt
gagattggtaaaaaattcgcaaacgttgacatcactaaagaaccaattccagtagtacca
acaatccattatcaaatgggtggtattcctacgaatatgcatggtcaagtgtgcttacca
gagcctggtacagacaactacactaaacctgtaaaaggtttctatgcaatcggtgagtgt
tcatgcgtatcagtacatggtgcgaaccgtttaggtactaactcacttcttgacttggtt
gtatttggtaaggctgctggtgagcacattatcgattacgtaactaaacatcatggtgat
gaatatgcgccgcttccaacaaatgtattagagcaaactttagctcgtgtacgtaaattg
gatgaatcaacttctggcgaaaatgctcaagaagttgctgatgcaattcgtgatatcgtt
caagaccacgcaggtgtattccgtactcaagcattgcttgataagggtgttaaagagatt
cttgctcttgaaccacgcgtgcgtaacatccacttgaaagataaatctaaagtatttaac
actgcacgtgttgaagcgcttgaagttgaaaacttatatgaagttgcaaaagctacatta
atttcagctgctgcgcgtaaagaatgtcgtggtgcgcatacggtagttgattatgaatta
ccagctgatcacccaacttattcatacggtcgccgtgatgatgagtggatgaaacatact
ttatggtattcatcagataaccgtttggaatataagccagtgcgcttcaagccgttaact
gttgatccaattccaccagcaccacgtacattctaa

DBGET integrated database retrieval system