KEGG   Acinetobacter baumannii AC29: BL01_06415Help
Entry
BL01_06415        CDS       T03377                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
abw  Acinetobacter baumannii AC29
Pathway
abw00480  Glutathione metabolism
abw01100  Metabolic pathways
abw01110  Biosynthesis of secondary metabolites
abw01120  Microbial metabolism in diverse environments
abw01130  Biosynthesis of antibiotics
abw01200  Carbon metabolism
abw01210  2-Oxocarboxylic acid metabolism
abw01230  Biosynthesis of amino acids
Module
abw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abw_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:abw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BL01_06415
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BL01_06415
Enzymes [BR:abw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BL01_06415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AIA51448
UniProt: V5VCI0
LinkDB All DBs
Position
1350200..1352437
Genome map
AA seq 745 aa AA seqDB search
MAGEKSTIIYTLTDEAPLLATYSLLPIIETFTKPAGIEIVKSDISVAARVLAEFADYLSE
EQKVSDNLAELGRLTQDPDTNIIKLPNISASVAQLTACIKELQSKGYAIPDYPENPATEE
EKTIKARYGKCLGSAVNPVLREGNSDRRAPAAVKNYAKKHPHSMSEWKQWSQTHVSHMEE
GDFYHGEKSMTLDRPRNVKMELITNSGKSIVLKPKVALQEGEIIDSMFMSKKALCDFYEK
QLDDCREAGILFSLHVKATMMKVSHPIVFGHCVKIYYKEAFEKHGKLFDELGINVNNGMA
GLYEKIETLPTSLREEIIEDLHACQEHRPALAMVDSAKGITNFHSPNDIIVDASMPAMIR
AGGKMWGADGKQYDAKAVMPESTFARIYQEMINFCKWHGNFDPKTMGTVPNVGLMAQKAE
EYGSHDKTFEIPEAGIANITDLDTGEVLLTQNVEEGDIWRMCQVKDAPIRDWVKLAVTRA
RNSGMPAIFWLDPYRPHENELIKKVQKYLKDHDTTGLDIQIMSQVRAMRYTLERVVRGLD
TISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVQQLVEEN
HLRWDSLGEFLALAVSLEEMGIKENNARAKLLAKTLDEATGKLLDNDKSPSRRTGELDNR
GSHFYLSLYWAEALAAQNEDAELKAKFAPLAKALAENEQKIVAELAQVQGKPADIGGYYA
VDPAKVSAVMRPSATFNAALSTVQA
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atggctggtgaaaagtcaaccatcatttacacactgactgacgaggcgccattattggcg
acttattcgctactgccgatcattgagacctttactaagccagctggtatcgagattgtt
aaaagtgacatctctgtagctgcacgtgtgctcgcagaattcgctgactacctaagtgaa
gagcaaaaggtatccgacaaccttgctgagctaggtcgtcttacacaagatccagatact
aacattatcaaactcccaaatattagtgcctctgttgcgcaattgacagcatgtattaaa
gaacttcaatctaaaggttatgcaattcctgactatccggaaaacccagcgactgaagaa
gaaaaaacaatcaaagctcgttatggcaaatgcctaggttcagcagtaaaccctgttctt
cgtgaaggtaactctgaccgtcgtgctcctgctgccgttaaaaattacgctaagaaacac
cctcactcaatgagcgagtggaaacaatggtcgcaaactcacgtttcacacatggaagaa
ggtgacttctaccacggtgaaaagtcaatgacacttgaccgtccacgcaatgtaaaaatg
gaacttatcacaaacagtggtaagagcattgttcttaagccaaaagttgcgcttcaagaa
ggcgaaatcattgactcaatgttcatgagcaaaaaagcgctttgcgacttctatgagaaa
caacttgatgactgccgtgaagcaggaattttattctcattacacgtaaaagcgacaatg
atgaaagtttcacacccgatcgttttcggtcactgtgtgaaaatctactataaagaagct
ttcgaaaaacacggtaagttgtttgacgaattaggtattaacgtaaataacggtatggct
gggttatacgagaaaatcgaaactcttccaacctcattacgtgaagaaatcattgaagat
ttacatgcttgccaagaacaccgtcctgcacttgcgatggttgactcagcaaaaggtatc
actaacttccattcacctaacgacatcatcgtagatgcttctatgcctgcaatgatccgt
gctggtggtaaaatgtggggtgctgatggtaagcaatacgatgctaaggcagtaatgcca
gaatcaacatttgcccgtatttaccaagaaatgatcaatttctgtaaatggcatggtaac
tttgatccaaaaacaatgggtacagtaccaaacgttggtttgatggctcaaaaagctgaa
gaatacggttctcacgacaagacttttgaaattcctgaagcaggtattgcaaacattact
gatcttgacactggtgaagtgttattgactcaaaatgttgaagaaggcgatatctggcgt
atgtgtcaggtgaaagacgctccgattcgtgactgggtaaaacttgcagtaactcgtgca
cgtaactcaggcatgcctgcgatcttctggcttgacccatatcgtccacacgaaaatgaa
ttgatcaagaaagtacagaagtacttaaaagatcacgatacgactggtcttgatatccag
atcatgtctcaagtacgtgcaatgcgttacacacttgagcgtgtagttcgtggcctcgat
acaatttctgtaaccggtaacatcttacgcgactacttaactgacttgttcccaattatg
gaacttggtacttctgcgaaaatgttgtctatcgttccgcttatggcgggtggtggcatg
tacgaaactggtgcgggtggttcagcacctaaacacgtacaacaacttgttgaagaaaac
cacttacgttgggattcgcttggtgagttccttgcgcttgcagtttctctagaagaaatg
ggtattaaagaaaataatgctcgtgcgaagttacttgcgaagacacttgatgaagcgact
ggtaaattgcttgacaatgacaagtctccatcacgtcgtacaggcgaacttgacaaccgt
ggcagtcacttctacttgtcactttactgggcagaagcacttgctgcacagaacgaagat
gctgagttgaaagctaaatttgctccacttgcaaaagcattagctgaaaacgaacagaag
atcgttgctgagcttgctcaagtacaaggtaaaccagctgatatcggtggttactatgca
gttgacccagcgaaagtaagcgctgtaatgcgtccaagtgctacatttaatgcagcgctt
tcaactgttcaggcttaa

DBGET integrated database retrieval system