KEGG   Acinetobacter baumannii AC29: BL01_06525Help
Entry
BL01_06525        CDS       T03377                                 

Definition
(GenBank) acyl-CoA desaturase
  KO
K00508  linoleoyl-CoA desaturase [EC:1.14.19.3]
Organism
abw  Acinetobacter baumannii AC29
Pathway
abw00591  Linoleic acid metabolism
abw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00591 Linoleic acid metabolism
    BL01_06525
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:abw01004]
    BL01_06525
Enzymes [BR:abw01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.3  acyl-CoA 6-desaturase
     BL01_06525
Lipid biosynthesis proteins [BR:abw01004]
 Desaturase
  Front-end
   BL01_06525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-ProteinID: AIA51470
UniProt: V5VB54
LinkDB All DBs
Position
1376720..1377814
Genome map
AA seq 364 aa AA seqDB search
MNMPVKVEYFKNPKNRDLTPAELEAFAKELDQIKQEVLDDLGEKDAKYIRRVYAAIRYSS
FLGRACLFAGWFPPAWILGTGLLGFSKIMENMELGHNVMHGQYDWMNDPKFNGQTYEWDT
VGTSDNWRQTHNYKHHTYTNIKGIDDDIGYGLLRLFPEQRWKPGFLLQPIYSIPFCLLFQ
WGVAIQNLEIGRVLYKRKTKAQFLEELKPVNKKIGKQLFKDYVFFPLIAGPAALPVFTGN
LVANGLRNIWTFSIIFCGHFTKDAEVFPKSVLQEESRGHWYMRQIRGSSNLTGSEAFHIL
SGHLSHQIEHHLFPDIPARRYRQMAPKVEAVCKKYGLNYNNASFVKQFGQVVGRIVKYAF
PFKK
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgccagtgaaagtcgaatattttaaaaatcctaaaaatcgagatttgactcca
gcagaacttgaagcatttgcaaaagagcttgatcagatcaaacaagaagtattggatgat
ttgggtgaaaaagacgctaaatatatccgccgtgtctatgctgctattcgttatagtagc
tttttaggccgagcttgtttatttgcaggttggttcccgccagcgtggattttaggtaca
ggtttattaggtttctctaaaattatggagaacatggagctcggccataatgttatgcac
ggtcaatatgactggatgaatgacccgaaatttaatggtcaaacttatgaatgggatact
gtaggtacctctgacaactggcgtcaaacccacaactataaacatcatacttataccaat
attaaaggtattgatgatgacattggttatggcttacttcgcttattccctgaacaacgt
tggaagccagggttcttattgcagcctatttacagtattccattttgcttattgttccag
tggggcgtagcaattcagaatcttgaaattgggcgtgtactttacaagcgtaaaactaag
gcacaatttttagaagagttaaaaccggttaataaaaagattggcaagcaactctttaaa
gattatgttttcttcccacttattgcagggccggcagcactaccagtatttacaggtaac
ttggtcgcaaatggccttcgtaatatctggacctttagtattattttctgtggtcatttc
acgaaagatgcagaagtgtttccaaaatctgttttacaagaagaaagccgtggacactgg
tatatgcgccaaattcgtggttcttctaacttaacaggttcagaagcattccatattttg
tctggtcacttaagtcatcaaattgaacatcacttattcccagatattcctgctcgtcgt
tatcgtcaaatggctccaaaagttgaggcggtttgtaagaaatatggcttgaactataac
aatgcaagctttgttaagcagtttggacaagtggttgggcgtattgtgaaatatgcgttc
ccatttaaaaaataa

DBGET integrated database retrieval system