KEGG   Acinetobacter baumannii AC29: BL01_07440
Entry
BL01_07440        CDS       T03377                                 

Definition
(GenBank) histidine kinase
  KO
K07639  two-component system, OmpR family, sensor histidine kinase RstB [EC:2.7.13.3]
Organism
abw  Acinetobacter baumannii AC29
Pathway
abw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:abw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BL01_07440
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:abw01001]
    BL01_07440
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:abw02022]
    BL01_07440
Enzymes [BR:abw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BL01_07440
Protein kinases [BR:abw01001]
 Histidine kinases
  OmpR family
   BL01_07440
Two-component system [BR:abw02022]
 OmpR family
  RstB-RstA
   BL01_07440
SSDB
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_3
Other DBs
NCBI-ProteinID: AIA51648
UniProt: Q2VSW5
LinkDB
Position
1581485..1583134
AA seq 549 aa
MFKHSIFLRIYAGLVILVVLVAVFGYLLVQIINYQRAQEYRESLTDGISYVISEGVARQP
GKQQKIDWISDASDLLELPIYYTDASKVELSRTEKKRIEAQKSVVRYDASNSIAYVIIGL
RDDPQHYLSIKVDKITERQMKALPIFVLDYLMFYPGQEQEYLAKIQKHFSYPINIQNIQD
VNLDSEQIGRLRQDQSVMLYKDSATVRGTTISIVSPIPNHPAQVLVLGPVPMFNWMPLQL
SAGITLFSLFLLSLGVYGLILPLERKIRQVRYALNRMKSGDLSLRVPIEGSDEMANLASS
YNNMSDHIQRLIEAQRELMRAVSHELRTPVARIRFGTEMLAEEDDYNHRMHQVDMIDKDI
EALNTLIDEIMTYAKLEQGTPSLDFAEIVLFEVLDQVAVETEALKTQKEIELIPPPLYVK
VDAERRYLHRVVQNLVGNAVRYCDNKVRITGGIHNDGMAFVCVEDDGPGIPEQDRKRVFE
AFARLDDSRTRASGGYGLGLSIVSRIAYWFGGEIKVDESPSLGGARFIMTWPAHRFKQPP
LKTNKKAPA
NT seq 1650 nt   +upstreamnt  +downstreamnt
gtgtttaaacacagtatattcctgcgaatatatgcggggctggtaattcttgttgttttg
gtagctgtttttgggtatttactggtacaaattatcaactaccaacgcgcacaagaatac
cgagaatctttaactgatggtatttcttatgtcattagtgaaggagtcgctcgacaacct
gggaagcagcaaaaaatagattggatttctgacgcatctgatttgctcgaacttccaatt
tattataccgatgcaagtaaggttgagctgtctcggaccgagaaaaagcggatagaagca
caaaaatctgtagttcgttacgatgcaagcaatagcattgcatatgtcattattggctta
cgtgacgacccacaacattacttatctataaaagtcgacaaaattactgaacgccaaatg
aaggctcttcctatttttgtgctcgactatttaatgttttatccggggcaggaacaagaa
tatcttgccaagattcaaaagcatttctcatatccgatcaatattcaaaatattcaagat
gtaaatctggattctgaacagattggacgtttgcgccaagaccaaagtgtcatgttgtac
aaagatagcgcaacagtgcgcggtacaaccatttcgattgtgtctccaataccgaatcat
cctgcgcaagtgttagtgctgggtccggttccaatgtttaactggatgcctttacagctt
tcggcgggtattaccttatttagcttattcttattaagtctaggtgtttacggtttgatt
ttgccgttagagcgcaaaatccgacaggtgcgttatgcattaaaccgtatgaaatcgggt
gatttgtcactgcgtgttcctattgagggaagcgatgaaatggcaaacttggcttcaagt
tataacaatatgtctgaccatattcagcgtttgattgaggctcaacgtgagttaatgaga
gcagtatctcatgaactcagaacacctgtggcacgtattcgctttggtacagaaatgtta
gccgaagaagatgattacaatcatcgtatgcatcaggtcgacatgattgataaagatatt
gaagcgctcaataccttaattgatgaaatcatgacttatgcaaaactagagcagggtaca
ccttcactagattttgcagaaattgtactcttcgaagtgttggatcaggttgcagttgaa
actgaggctttaaaaacacagaaagaaattgaacttattccaccgcctttatatgtgaaa
gtagatgcagagcgtcgttaccttcaccgtgtcgtgcaaaatctagtaggtaatgcagtt
cgttattgtgataacaaagttcggattacgggcggtattcataatgatggcatggctttt
gtctgtgtcgaagacgacggaccgggtattcctgagcaagaccgcaagcgtgtatttgaa
gcctttgcccgtttagatgatagccgtacacgtgcatctggcggttatggtttgggtctc
tctatcgtaagtcgtattgcttactggtttggtggggaaattaaggtagatgaaagtcca
agtttgggaggcgcacgctttattatgacttggccagcacatcgctttaaacaaccgcca
ttaaagaccaataaaaaagcacctgcataa

DBGET integrated database retrieval system