KEGG   Acinetobacter baumannii AC29: BL01_08235Help
Entry
BL01_08235        CDS       T03377                                 

Definition
(GenBank) diguanylate cyclase
Organism
abw  Acinetobacter baumannii AC29
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GGDEF DUF212 GGDEF_2 UPF0370
Motif
Other DBs
NCBI-ProteinID: AIA51800
UniProt: V5VEW6
LinkDB All DBs
Position
1747340..1748569
Genome map
AA seq 409 aa AA seqDB search
MKLQGSNILGQEQIDLLTTRGLNFVWFPKQLETIYRFQYQNGAAYEFRYRAPIILILYLF
LSFGIYQVLPTEQVLSWLSYYSWVGIIVLIAWILSFIKKLNQWFDYYVGIGSSAAVAITF
ILINVLENGQDNVLFHAAMMYAIVIIYGAVGMRFYTAIIAGWVGGLIGILVSTYLNGDID
WTFLNRTYTFSSFLGMTLAYATDRQHRENYLQNCMIELNRIELMQQAQQLSLLSQQDALT
GLANRRYLDETLDNEWRRALRHETPLTIMMVDIDFFKPYNDSLGHLKGDQCLKDIATAIS
SIAARSGDLVARYGGEEFLLLFPMTNAQQAKIQAERLMNAIKKIAIVHPCSSVSPYVTIS
VGVATTIPRLNDSISAFVSRADHALYQAKTNGRNQYQIALNEEQIVDLT
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgcaaggttccaatatattgggacaggaacaaatagatttattaaccacacgc
ggattaaatttcgtatggtttccaaagcaacttgaaacgatatatcgttttcaatatcaa
aatggtgcagcctatgagtttcgctatagagcacctattattttaatattatatttattt
ttaagctttggtatataccaagtcttaccaaccgaacaagttttatcctggttaagctat
tattcttgggtaggcataattgttttaatcgcctggattttatcatttattaaaaaatta
aatcagtggtttgattattatgtcggaattggctcttccgctgccgttgccataacattt
attttaattaacgttttagaaaatggccaagataatgtactttttcatgcagcaatgatg
tatgccattgtgattatctatggtgcggtaggcatgcgtttttatactgccattattgca
ggatgggtcggcggtcttattggtattttggtaagcacctatttgaacggagacatagac
tggaccttcttgaaccgtacatatacgtttagtagtttcttaggcatgacccttgcctat
gctacggatcgtcagcaccgtgaaaactatttacaaaactgtatgattgagctcaaccgt
attgaactcatgcaacaagctcaacaactgtcactgctttctcaacaagatgctttaacc
gggcttgctaaccgacgttatcttgatgaaacacttgataatgaatggcgacgcgcatta
cgccatgagactcctcttactattatgatggttgatattgacttctttaaaccatataac
gatagcttaggccatctcaagggtgatcagtgtttaaaagatattgcgactgcaatttcc
tcaattgctgctcgtagtggcgatttggttgcccgttatggcggtgaagaattcttactt
ctgttcccaatgacaaatgcacaacaagccaaaattcaggccgaaagattaatgaatgca
attaagaaaattgctattgttcatccatgtagtagtgtttcaccatacgtaaccattagt
gttggcgtggcgaccacaattccacgtttaaatgattcaatttctgcttttgttagtcgt
gctgatcatgcgctctatcaggcaaaaacaaatggccgcaatcaatatcaaattgctttg
aatgaagaacaaattgtagatctaacttaa

DBGET integrated database retrieval system