KEGG   Acinetobacter baumannii 1656-2: ABK1_0130Help
Entry
ABK1_0130         CDS       T01819                                 

Definition
(GenBank) dadX
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
abx  Acinetobacter baumannii 1656-2
Pathway
abx00473  D-Alanine metabolism
abx01100  Metabolic pathways
abx01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:abx00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    ABK1_0130
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    ABK1_0130
Enzymes [BR:abx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     ABK1_0130
Peptidoglycan biosynthesis and degradation proteins [BR:abx01011]
 Precursor biosynthesis
  Racemase
   ABK1_0130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ADX01764
LinkDB All DBs
Position
141814..142917
Genome map
AA seq 367 aa AA seqDB search
MPRPITAVIHRQALQNNLAVVRKAMPNSKVFAVVKANAYGHGIERVYEAFKAADGFALLD
LEEAKRIRALGWTGPILLLEGVFSPQDLFDCVQYQLSFTIHSEAQIEWVEQHPYPAQFDV
FLKMNSGMNRLGFKPQNYVQAWERLNNLANVSKITHMTHFSDADADRFGQQGIDYQITAF
EEIVRDLPGERSVSNSAAILRYQDQLKSDYARSGIMLYGSSPDYPTHSIADWGLQPTMSL
RSEIIAVQHLEPNESVGYGSNFVAEQPMTIGIVACGYADGYQRISPTGTPVLVDSVRTRT
VGRVSMDMLAVDLTGIESAKVGSEVVLWGQSSTGVVLPIDDVAVSSGTVGYELMCAVTAR
VQFINQV
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgtcctattaccgcagtgatccaccgccaagccttacaaaataacttggcggtg
gtacgcaaggctatgccaaacagtaaggtctttgccgttgtaaaagccaatgcttatgga
catggaattgaacgtgtttatgaagcgtttaaagcagcagatggctttgccttactggat
cttgaagaagcaaaacgaattcgtgctctaggctggacaggtccaattttattgcttgaa
ggagttttttctcctcaagatttatttgattgtgtgcagtatcaacttagtttcaccatt
catagtgaagcgcaaattgagtgggtagaacagcatccttatcctgctcaatttgatgtt
ttcttgaaaatgaacagtggtatgaaccgtcttggttttaaaccacaaaactatgttcag
gcttgggaacgtttaaataacttggcaaatgtgtccaagattacgcacatgacgcatttt
tcagatgcagatgccgatcgttttgggcagcaaggcattgattatcaaattactgccttt
gaagaaattgtgagggatttaccgggtgaaagatcggtaagtaatagcgcggcaattctg
cgctatcaagaccagctcaaatcagattatgcacgtagcggcatcatgctttatggcagc
tcgccagattacccgacgcatagtattgcggattggggcttacaaccgactatgagctta
cgcagcgaaattattgccgttcagcatttagaaccgaatgaaagcgtaggttatggctca
aactttgtcgcagagcagcccatgacgattgggattgtggcttgcggctatgccgatggt
tatcagcgtatttcaccaacaggtactccagttttagtggactcagtacgcacgcgtaca
gttggccgcgtcagtatggatatgttggcagtcgatttaacgggtattgagagtgccaaa
gttggtagtgaagtggtgctctggggtcagtcaagtacaggcgtcgttctacctattgac
gatgttgcagtttcatccggtacggtgggttatgaactgatgtgtgccgtcaccgcccgt
gttcaatttattaatcaggtataa

DBGET integrated database retrieval system