KEGG   Acinetobacter baumannii 1656-2: ABK1_2130
Entry
ABK1_2130         CDS       T01819                                 

Definition
(GenBank) Putative siderophore biosynthesis protein
Organism
abx  Acinetobacter baumannii 1656-2
SSDB
Motif
Pfam: IucA_IucC FhuF
Other DBs
NCBI-ProteinID: ADX03764
LinkDB
Position
2245841..2247625
AA seq 594 aa
MQELANRLAIQNFVNAYMQETGKGYLLSFDQQSSTQQAFSSGLTLLTLPLPSIQAECSVP
LSYVSRVGRHRLAALPKMCIDGQWQKFSAGTIVSLLLEELVIESQFKLDAASLLEKWIQS
RDALLQFLKQRHNDFDDLVKAGQNFIESEQALILGHSMHPAPKSRNGFVHEDWLKFSPEH
AGKTQLYYWLVHQNYIAEGCATEQPISDQVKDAIRWYLSESDLNLLKTHVEFKLLPLHPW
QARYLQGKPWFEQLKQTGQLIDIGLRGWQFSPTTSIRTLASFNAPWMVKTSLSVMITNSI
RVNLAKECHRGEISYRLWHSDLGKKILKQCPTLKAVNDPAWIALQIDGEIINETICIFRD
QPFAVQQQVTCIASLCQDHPNKELNRFNALFDQIAQKNQQTNFKEIALDWFDHFLKIGLA
PLMYVYHKYGMAFESHQQNVLLELEDGLPKNLWLRDNQGFYYIEEFATEIVEALPDLLEK
AHAVGPKDFVDERFSYYFFGNTLFGLINAIGATGYISEDELLIHLQQNLLQLLEQYPDST
LLQGLLFNDSLPYKGNLLTRLHELDELIAPLEHQSVYVQLPNPLYVEQKDVSYA
NT seq 1785 nt   +upstreamnt  +downstreamnt
atgcaagaacttgccaaccgattggcgatacaaaatttcgtcaacgcttatatgcaagag
actggcaaaggatatttactttcttttgaccaacaaagttcaactcaacaagcgtttagc
tctggtttgacgctgttaactcttcctcttccttctatacaagcagaatgctctgtacct
ttatcttatgtaagtcgtgtaggacgccatcgtctcgctgctttaccgaaaatgtgtatt
gatggtcaatggcaaaaattcagtgcaggaaccattgttagtcttttacttgaagagttg
gttattgaatctcaattcaaattagatgctgcttcattgttagagaaatggatacaaagc
cgggacgcgctactacaattcttaaaacaacgccataatgatttcgatgatttagtaaag
gctggacagaattttattgaaagcgaacaggcattaattttgggtcatagtatgcaccca
gcgcctaaaagccggaatggttttgttcatgaagattggttgaagttttcacctgaacat
gctggaaaaactcagttatattattggcttgttcatcagaattatattgctgaaggttgt
gcaactgagcagccaatttcagatcaagttaaagacgcaatccgttggtatttgtccgaa
agcgatttaaacctgttaaagactcatgttgaatttaaattattgccactacatccttgg
caagctcgttatttacaaggtaaaccttggtttgagcaattaaaacaaacaggacagtta
attgatatcggtttacgtggatggcaattttcaccgactacatcaattcggaccttggca
agttttaacgccccttggatggttaaaacttcactatcagtcatgatcactaattcaatt
cgagtgaatttggcaaaagagtgtcatcgtggcgaaatttcttatcgtttatggcacagt
gatttaggtaaaaaaatattaaaacaatgcccaacattgaaagcagttaatgatccagcc
tggatagctctgcaaatagacggcgagattattaacgagacaatttgtattttccgtgat
caaccatttgcagtacagcaacaagtcacttgtattgcatctttatgtcaagaccatcca
aataaagagttaaatcgttttaatgctttatttgaccaaattgctcagaaaaatcaacaa
acgaattttaaagaaattgctttggattggtttgatcatttcttgaagattggcttggct
ccgttaatgtatgtttatcataaatacggtatggcttttgaatcgcatcaacaaaatgta
ttgcttgagctagaagatggtttaccgaaaaatctctggttacgtgacaaccaaggcttt
tattatattgaagagtttgcaactgaaattgtagaagcattaccagatttactagaaaaa
gctcatgcggttggtcctaaagattttgtggatgaacgctttagttattatttctttggc
aacactttatttggtttgattaatgcaattggagcaactggctatatttctgaagatgaa
ctgttaatccatttgcaacaaaatttacttcaattattagagcaatatccagatagcaca
ttattacagggtttattgtttaacgattctttaccgtataaaggcaatttacttacacgt
ttacatgaattagatgagcttattgcaccattagaacatcagtctgtgtatgtgcagcta
ccaaatccactgtacgttgaacagaaggatgtgagctatgcttga

DBGET integrated database retrieval system