KEGG   Acinetobacter baumannii 1656-2: ABK1_2199Help
Entry
ABK1_2199         CDS       T01819                                 

Definition
(GenBank) threonine dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
abx  Acinetobacter baumannii 1656-2
Pathway
abx00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:abx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ABK1_2199
Enzymes [BR:abx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     ABK1_2199
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     ABK1_2199
    1.1.1.-  
     ABK1_2199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 Semialdhyde_dh FAD_binding_3 2-Hacid_dh_C TrkA_N
Motif
Other DBs
NCBI-ProteinID: ADX03833
LinkDB All DBs
Position
2315014..2316072
Genome map
AA seq 352 aa AA seqDB search
MKAARFYDRGDIRIEDIPEPEVTPGTVGIKVAWCGICGTDLHEFMEGPIFIPPCGHPHPI
SGESAPITMGHEFSGVVYAVGEGVDDIEIGQHVVVEPYIVADDVPTGPGDNYHLSKNMNF
IGLGGRGGGLSEKIAVKRRWVHPISNKIPLDQAALIEPLSVGHHAFVRSGAKAGDIALVG
GAGPIGLLLSAILKAKGLKVIITELSAKRKEKAKESGVADYILDPSEVDVVSEVMKITNG
DGVDVAFECSSVNKVLDTLVAAVKPTGVIVIVSIWSHPASINVHSVVMKELDVRGTIAYV
NDHQETIKLVEEGKINLEPFITQRIQLDDLISQGFETLIHNNESAVKIIVHP
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcgcgtttttatgacagaggtgatattcgtattgaagatatccctgaacca
gaagtcactcccggcactgtaggcattaaggtagcttggtgtggaatctgtggtacagat
ttgcacgaatttatggaaggaccaatttttattccaccgtgtggacatccgcatcctatt
tcaggcgaatctgcgccgattactatgggacatgagttttcaggtgtggtttatgccgta
ggtgaaggtgtcgatgatattgaaattggtcagcatgtagtcgtagagccttatattgtg
gctgatgatgtgccgactggaccgggcgataattatcatctttccaaaaatatgaacttt
attggtttaggcggtcgtggcggtggcttatcggagaaaattgcggttaaacgccgttgg
gtgcatccaatttccaataaaattccattagatcaagcggccttaattgaaccgttatcg
gtgggtcatcatgctttcgtacgtagtggtgcaaaggccggtgatattgcactggttggc
ggtgcggggccaattggtttattgctttcggcaattttaaaagcgaaagggcttaaggtc
atcattaccgaactaagtgccaaacgtaaagaaaaagccaaagagtcgggagttgcagat
tatattttagacccgtcagaagttgatgttgtttctgaggtcatgaaaattactaatggc
gatggtgttgatgttgcgtttgaatgtagtagcgttaacaaggtgttagatactttggtc
gcggcagtgaaaccaacaggcgttatagttattgtttcgatttggagccacccagcatca
attaatgtgcacagtgtggtaatgaaagagcttgatgtacgcggcacaattgcctatgta
aatgaccatcaggagactattaaactggttgaagaaggtaaaataaatcttgaacctttt
attacgcagcgcattcaacttgatgatttgatttcacaaggttttgaaaccttaattcat
aacaatgagtcagccgttaagattattgtacatccataa

DBGET integrated database retrieval system