KEGG   Acinetobacter baumannii 1656-2: ABK1_2773Help
Entry
ABK1_2773         CDS       T01819                                 

Definition
(GenBank) pstB
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
abx  Acinetobacter baumannii 1656-2
Pathway
abx02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:abx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ABK1_2773
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:abx02000]
    ABK1_2773
Enzymes [BR:abx01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     ABK1_2773
Transporters [BR:abx02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    ABK1_2773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 RsgA_GTPase AAA_22 AAA_33 AAA_29 Rad17 AAA_16 AAA_28 AAA_18 PRK AAA_23 RNA_helicase AAA_24 G-alpha AAA_30 NB-ARC MMR_HSR1 NACHT AAA_14
Motif
Other DBs
NCBI-ProteinID: ADX04407
LinkDB All DBs
Position
complement(2905659..2906516)
Genome map
AA seq 285 aa AA seqDB search
MNTEQSQLTDTQLHHGTSYVSHFEPHASKKPNSTEIKISAQDAHVYYGDFEAIKGIDLDI
YQNEVIAFIGPSGCGKSTFLRTLNRMNDTIDGCRVTGKITLDNKNIYDPNLDVVLLRAQV
GMVFQKPNPFPKSIFDNVAYGPKLHGLARDKYDLEEIVENSLRKAGLWEEVKDRLNQPGT
GLSGGQQQRLCIARTIAVSPEVILMDEPCSALDPIATAKVEELISELSDQYTIVIVTHSM
QQAARVSDRTAYFHLGDLIEVNSTEKVFTQPDHQLTEAYITGRFG
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtgaatactgaacaatctcaacttacagatacacaactgcatcatggcacttcgtacgtt
tcgcattttgaaccacatgcttcaaaaaagccaaactcaaccgaaatcaagatcagtgca
caagatgcccatgtttattatggtgactttgaagcgattaaaggcatcgatttagatatt
tatcaaaatgaagtaattgcgtttattgggccatcaggctgcggtaaatcgactttcctg
cgtactttaaaccgtatgaacgacacgattgatggctgtcgtgtgacaggtaagatcact
ctagataacaaaaatatctatgatccaaatctggatgttgtattgctgcgtgcacaggtt
ggtatggtgttccaaaagccaaatccatttcctaaatctatttttgataacgtggcatat
ggtccgaagctacacggtttagcacgtgacaaatatgacctagaagaaattgttgaaaat
agcttgcgtaaagcaggtctatgggaagaagtgaaggatcgtttaaaccaaccgggtact
ggcttatctggtggccagcaacaacgtttatgtattgcacgtacaattgcagtaagtcca
gaagtgatcttgatggatgaaccttgttctgcacttgacccaatcgcaacggcaaaagtg
gaagagctgatttctgaactgtctgatcaatacacaatcgttattgtaacgcactcgatg
caacaagcagcgcgtgtttcagaccgtacagcttacttccatttaggtgatttgattgaa
gtaaactctacagagaaagtatttactcagcctgaccatcaattgacagaagcgtacatt
actggccgtttcggttaa

DBGET integrated database retrieval system