KEGG   Acinetobacter baumannii 1656-2: ABK1_3209Help
Entry
ABK1_3209         CDS       T01819                                 

Definition
(GenBank) glnE
  KO
K00982  [glutamine synthetase] adenylyltransferase / [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase [EC:2.7.7.42 2.7.7.89]
Organism
abx  Acinetobacter baumannii 1656-2
Brite
KEGG Orthology (KO) [BR:abx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ABK1_3209
Enzymes [BR:abx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.42  [glutamine synthetase] adenylyltransferase
     ABK1_3209
    2.7.7.89  [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase
     ABK1_3209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlnE GlnD_UR_UTase
Motif
Other DBs
NCBI-ProteinID: ADX04843
LinkDB All DBs
Position
complement(3400602..3403352)
Genome map
AA seq 916 aa AA seqDB search
MNAEQLQKTLRASQYAEQVLGLHQAVLEQDYQIDQFAAPLSTEQIYQLVDITLDGIGDEI
TWMRALRILRSRLMFRWIWQDANQLTDVVTLTRELSDFADASICAAKAFARVALVAKHGE
PLSYSGKVQDLIVVAMGKLGAQELNLSSDIDLIFAFDEQGETNGRKCIDVQQFCILWGQK
LIYLLEHITADGFVFRVDMRLRPWGDGSALAISHAALEKYLSQHGREWERYAWIKARVVT
GGKEGQDLLEMTRPFVFRRYVDYTAFAAMRDMKAMIEREVLRRHIEDDIKLGAGGIREIE
FIVQVFQLIYGGSKRELQDRQCLVSLEHIGEAGLLEKQAVQELEDAYLFLRRVEHAIQAL
NDQQTQLLPEEADLRQRIIDTLGFTSWNEFIDVLNEKRQKVKVQFKQLIEDTSSNAATEN
FGQLEQQLDEVLDDNAKNLIHEFWHGHALKKLPSNAVQRLKTFWPHLIEAILQSEQPQTA
LLRLMPLIESVMRRTVYLVMLIESKGALQRLVKMATVSPWICEELTQYPVLLDEFLSMDF
ELPKRKDLEDSLRQQLLRIEIDQVEDQMRVLRLFKKSNVLTVAASDVLAESPLMKVSDAL
TDIAEVSVNATLNLAYQTVAKRHGYPKDVEGKRCSLDYKAFAVIGYGKVGGIELGYGSDL
DLVFIHYLDEQADTDGTKSITGFEFAMRVAQKFMSLITTQTLDGRVYEIDTRLRPSGEAG
LLVTSLKAYEHYQLKSAWLWEHQALVRARSIAGDEALCQKFEIFRREILTQSRDEAYVRE
EVLKMRQKMKDHLGSSSEQKKHGIFHLKQDAGGIVDIEFMAQYAVLAWSGTKPDLAHYSD
NVRILEDAAKADCLSSEDATALIRAYLSERAESHRLALANQSMQVSAADWRSTRAVVCNL
WQRLIDPTASVELDSE
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcggagcagttacaaaaaacattgcgtgccagccaatatgctgaacaagtttta
ggattacatcaggctgttttagaacaagattatcaaatagatcaatttgctgcaccgctc
tcaacagaacaaatttaccaacttgtagacatcacgcttgatggaattggcgatgaaata
acttggatgcgtgcgcttcgtatactgcgcagtcgtttaatgtttcgctggatctggcaa
gatgccaatcaactgacggatgtcgttacacttactcgtgaactttcagactttgccgat
gcaagtatttgtgccgcaaaggcttttgctcgtgttgcattggttgctaaacacggcgaa
ccattaagttattcaggcaaagttcaagatttgattgtggttgccatgggtaagcttggg
gcacaggaattaaatctatcaagtgatatcgacctgatttttgcctttgatgagcaaggc
gaaaccaacggtcgtaaatgtattgatgtacagcagttttgtattttgtggggacaaaaa
cttatttatttacttgaacatatcaccgcagatggttttgtgtttcgagtagacatgcgc
ttacggccttggggagatggctctgcattagcgattagtcatgcagctttagaaaaatat
ttaagtcagcatggccgtgaatgggaacgttacgcatggattaaggcacgcgttgtcact
gggggtaaagaagggcaagacttattagaaatgacacgtccttttgtattccgccgttat
gtcgattacaccgcttttgctgccatgcgcgatatgaaagcgatgattgagcgcgaagta
ttacgccggcatattgaagatgacattaaactcggggcaggcggtatacgcgaaattgag
tttattgttcaggtgttccagcttatttacggcggttctaaacgtgagctgcaagaccgt
caatgtttagttagtcttgaacatattggtgaggcaggcttgttagaaaaacaggccgta
caagagcttgaagatgcttacctattcttacgccgtgttgaacatgcaattcaagccttg
aatgatcaacaaacgcaactattaccagaagaagcagatttacgacaacgcattatagat
actttgggttttacgagttggaatgaatttattgatgttcttaacgagaaacgccaaaaa
gtaaaagttcagtttaagcagctcattgaagacacaagttccaatgcagctaccgagaac
tttggacagttagagcagcagctagatgaagtgttagatgataatgcaaaaaatctgatt
catgagttctggcatggtcatgcacttaaaaaacttccttccaatgccgtgcagcgttta
aaaacattttggccccatttaattgaagccattttacagtctgaacaaccacaaactgca
ttattacgtttaatgccactgattgaatcagtcatgcgtcgaaccgtctatttggtaatg
ctgattgaaagtaaaggggcattacaacgcttagtaaaaatggcgacagtgagcccgtgg
atttgtgaagagttaacccaatatcctgtattgctggatgagttcttgtcgatggacttt
gagttaccaaagcgtaaggacttggaagactcattacgtcagcaattacttcgtatcgaa
attgatcaggtcgaagatcaaatgcgggtacttcgcctatttaaaaagagtaatgtgtta
acggtcgctgcaagtgatgtgttagctgaaagtcctcttatgaaggtctctgatgctttg
acagatattgcagaagtcagtgttaatgcaactcttaatttagcttatcagactgtagca
aaacgtcatggttacccaaaagatgtcgagggaaaacgttgttcactcgattataaagcc
tttgccgttattggttatggcaaggtgggtggcattgaactgggctatggttcggactta
gatcttgtctttattcactatctagatgaacaagccgacacggatggtactaagtcaata
acaggttttgagtttgccatgcgtgtcgctcaaaagtttatgtctttaatcaccactcaa
acgcttgatggccgcgtttatgaaattgatacacgtttaagaccttcaggtgaggctggt
ttattggtgacaagcctgaaagcctatgagcattatcagttgaaaagtgcatggctttgg
gagcatcaggcattagttcgtgcacgttctattgcaggtgatgaagcgctttgccaaaaa
tttgaaatatttcgccgcgagatattgactcaatctagagatgaggcttatgttcgtgaa
gaagtgctgaaaatgcgtcagaaaatgaaagaccacttaggttcatcttctgaacaaaaa
aaacatggtatttttcatttaaaacaggacgcaggtggtatcgtagatatcgaatttatg
gcacagtatgctgtacttgcatggagcgggacgaaacccgatctcgcccattattctgat
aatgtaagaatattagaagatgctgctaaagcagactgcttatccagtgaagatgccaca
gcattaattcgagcctatcttagtgaacgtgccgaaagccaccgcttagcccttgcgaat
caatccatgcaagtaagcgcagcggactggcgtagtacccgtgcggtcgtttgcaattta
tggcaaagattaatagacccaaccgcctcggttgagttggatagtgaatga

DBGET integrated database retrieval system