KEGG   Acinetobacter baumannii 1656-2: ABK1_3446Help
Entry
ABK1_3446         CDS       T01819                                 

Definition
(GenBank) PonA
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
abx  Acinetobacter baumannii 1656-2
Pathway
abx00550  Peptidoglycan biosynthesis
abx01100  Metabolic pathways
abx01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:abx00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ABK1_3446
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ABK1_3446
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:abx01003]
    ABK1_3446
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:abx01011]
    ABK1_3446
Enzymes [BR:abx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     ABK1_3446
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ABK1_3446
Glycosyltransferases [BR:abx01003]
 Polysaccharide
  Bacterial polysaccharide
   ABK1_3446
Peptidoglycan biosynthesis and degradation proteins [BR:abx01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   ABK1_3446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: ADX05080
LinkDB All DBs
Structure
PDB: 

Position
3645707..3648187
Genome map
AA seq 826 aa AA seqDB search
MGFYGMYLYIAPTLPEMSSLKKAPLLKPLQVYTADNQLIAEYGGKLSIPVEYKQIPPNFI
HAFLAAEDSSFFEHSGISFKGLGRALSESVTGSDVQTGGSTITMQVAKNYYLSPERTLKR
KITEIFLARKIEQNLSKEDILSLYVNKIFLGKNAYGIAAAAKIYYNKSINELSIAQMAMI
AGLPKAPSKYNPVVNPERALERRNWILGRMLQLGYISQAEYQKAVAEPINLNMPNRDLNN
IHPYAGEMVRSELVKHFGEQAIDSGYKVYTTINAKRQAIAEKAVQDGLEAYDRRHGWRGA
EAHDKPLSEFRAYANTYPAQVTKVNSSSFEALMQDGSTVTVQWSGMSWARPYRNANSVGA
APSRASQIVKVKDIVRLRPNEAKTAWSLVQVPKVQCQLIAINPNDGSIEAIVGGYNFYQS
KFNRALQGWRQPGSTIKPFLYALALERGMTPYSMVNDSPITIGKWTPKNSDGRYLGMIPL
RRALYLSRNTVSVRLLQTVGIERTRQLFMDFGLQEDQIPRNYTIALGTPQVLPIQMATGY
ATFANGGYRVQPHFIQRIEDAYGKVIYEAKPEYACIPCINAPETTDDAQVTTPDDQVVEV
TNKELEQKEKTTKQLNLKQTDKNNSQYRQAQRILKSSSAYDMANILRDVIEHGTGRAALK
IGRSDLGGKTGTTNDAKDAWFAGFNGKLVTVTWVGFDQPTTLGRREYGGIAALPIWINFM
GQALQGTPAAWVRLEKDAQAPISRDKQEVTTEVGDKKTYRAAPPLARPLYRPAPPQPKTT
NNDFDDLPGEEIVIPSKTTPPAMKPSQGAAPKREKDELENLINQIE
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atgggattctatggcatgtatctctatattgccccaacgcttccggaaatgagttcacta
aaaaaagcaccgcttttaaaaccattgcaagtctatacagccgacaatcaactcattgct
gaatacggtggtaaactttctattccggttgaatacaaacaaattcctcctaattttatt
catgcatttctagcagcagaagattcttctttctttgaacatagtggcattagttttaaa
ggtttaggtcgtgctttgagtgaaagtgtaactggttctgatgtacaaactggtggttca
accatcacgatgcaggtcgcaaagaactattatttaagtccagaaagaacactaaaacgc
aaaataacagaaatctttttggctcgaaaaattgagcaaaacttatccaaagaagacatc
ttgagcctctatgtgaataagattttcttaggtaaaaacgcttacggtatcgcagcggct
gcaaagatttactacaacaaaagcattaatgagctcagcattgcccaaatggccatgatt
gccggcttgcctaaagcaccatctaaatataatccagttgttaaccctgagcgtgcactt
gaacgtcgcaactggattttaggccgaatgcttcaacttggttatatttctcaagcagaa
tatcaaaaggccgttgcagagccaatcaatttgaatatgcccaaccgtgacctaaataat
attcacccctacgcaggtgaaatggtccgctcagagcttgtaaaacattttggtgaacaa
gcaattgattctggttataaagtctacacaacaattaatgcgaaacgccaagcgattgcg
gaaaaagctgtgcaggacggtcttgaagcttatgaccgtcgtcatggctggcgtggtgca
gaagcacatgataagccattaagcgaatttagagcatatgccaacacttatccggcgcaa
gtcaccaaggtaaatagcagctcttttgaagcattaatgcaagatggctcaacagtaacc
gtgcaatggtccggcatgtcatgggcccgtccctatcgcaatgcaaatagcgtaggggca
gcgccttctcgtgcatctcaaattgttaaagttaaagatattgttcgtttacgcccaaat
gaagctaaaactgcgtggtcactagttcaagtaccaaaagttcaatgtcagctcattgca
attaacccaaacgatggctcaattgaagcaattgtaggtggttataatttctatcaatca
aaatttaaccgtgctttacaaggctggcgtcagccaggttctaccatcaaaccattcctc
tatgctttagcattagaacgtggcatgacaccttatagtatggtgaatgatagccctatt
acgattggcaagtggacaccgaagaactctgatggtcgctacctaggtatgatcccgtta
cgccgtgctttgtatttgtctcgtaatacggtttcagtaaggctcttacaaactgtagga
attgaacgtactcgccaattattcatggattttggtttacaagaggatcaaattccacgt
aactacaccattgctttaggtacgcctcaagtattaccaattcaaatggcaactggatat
gcaacattcgcaaacggtggttaccgcgttcaaccgcattttattcagcgtattgaagat
gcatacggtaaagtcatttacgaagccaaaccagaatatgcatgtattccatgtattaac
gctcctgagacaactgacgatgcacaggtaactactccagatgatcaagttgttgaagtt
acaaataaagagctagagcagaaagaaaagacaaccaaacaacttaatcttaaacagacg
gacaaaaataacagtcaatatcgtcaagctcagcgcattttaaaatcaagctctgcttat
gacatggcaaatatcttacgtgacgtaattgagcatggtacaggtcgtgctgcactcaag
attggccgtagtgatttaggaggtaaaacaggtacgactaacgatgcaaaagatgcatgg
tttgcaggttttaatggcaagttagtaactgtaacatgggttggttttgaccagccgact
acacttggtcgccgtgagtatggtggtattgctgcactaccaatctggattaactttatg
ggtcaagcattgcaaggtacaccagctgcttgggttcgtttagaaaaagatgctcaggca
cctatttctcgcgataagcaagaagtcacaactgaagtaggcgataagaaaacctatcgt
gctgcccctccattagcacgcccactctatcgtcctgcaccaccacaacctaaaaccacc
aataatgacttcgatgacttaccgggtgaggaaattgtgattccttccaagacaacacct
ccagcgatgaaaccttcgcaaggggcagcgccgaagcgtgaaaaagatgaattagaaaac
ttgattaatcaaattgagtaa

DBGET integrated database retrieval system