KEGG   Acinetobacter baumannii AYE: ABAYE0776Help
Entry
ABAYE0776         CDS       T00667                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
aby  Acinetobacter baumannii AYE
Pathway
aby00020  Citrate cycle (TCA cycle)
aby00190  Oxidative phosphorylation
aby00650  Butanoate metabolism
aby01100  Metabolic pathways
aby01110  Biosynthesis of secondary metabolites
aby01120  Microbial metabolism in diverse environments
aby01130  Biosynthesis of antibiotics
aby01200  Carbon metabolism
Module
aby_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aby_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
aby_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:aby00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABAYE0776 (sdhA)
   00650 Butanoate metabolism
    ABAYE0776 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ABAYE0776 (sdhA)
Enzymes [BR:aby01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ABAYE0776 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     ABAYE0776 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO Thi4 Pyr_redox_2 GIDA HI0933_like FAD_binding_3 NAD_binding_8 Pyr_redox_3 NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: CAM85734
UniProt: B0VEH0
LinkDB All DBs
Position
794711..796546
Genome map
AA seq 611 aa AA seqDB search
MGAINPKEDYSNIQNLTFDAVIVGGGGSGMRASYQLAQAGLKVAVLTKVFPTRSHTVAAQ
GGIGASLGNMQEDNWHFHFYDTVKGSDWLGDQDAIEFMCREAPKVVYELEHLGMPFDRNA
DGTIYQRPFGGHSANYGDKPVPRACAAADRTGHALLHTLYQSNVKMGTQFFVEWIALDLI
RNEAGDVLGVTAIDQETGNIAVFQAKATLFATGGAGRVYRASTNAYINTGDGLGMAARAG
IPLQDMEFWQFHPTGVAGAGVLLTEGCRGEGAILRNKDGEPFMERYAPTLKDLAPRDFVS
RSMDQEIKEGRGCGPKGDYILLDMTHLGADTIMKRLPSVFEIGKKFANVDITKEPIPVVP
TIHYQMGGIPTNMHGQVCLPEPGTDNYTKPVKGFYAIGECSCVSVHGANRLGTNSLLDLV
VFGKAAGEHIIDYVTKHHGDEYAPLPTNVLEQTLARVRKLDESTSGENAQEVADAIRDIV
QDHAGVFRTQALLDKGVKEILALEPRVRNIHLKDKSKVFNTARVEALEVENLYEVAKATL
ISAAARKECRGAHTVVDYELPADHPTYSYGRRDDEWMKHTLWYSSDNRLEYKPVRFKPLT
VDPIPPAPRTF
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcgataaaccctaaagaagattattcaaatattcaaaacctcactttcgatgct
gttatcgttggtggtggtggttctggtatgcgtgcatcttaccaacttgctcaagcaggt
ttgaaagttgcagtacttactaaagttttcccaacacgttcacatacagttgctgctcag
ggcggtattggtgcgtcgttaggtaacatgcaagaagataactggcatttccacttttac
gatacagtaaaaggttctgactggttaggtgaccaagacgcaatcgaatttatgtgtcgt
gaggcgccaaaagttgtttatgaacttgaacacttaggtatgccgttcgaccgtaacgct
gatggtacaatttaccaacgtccgttcggtggtcactctgcaaactatggtgataagcca
gttccacgtgcttgtgctgctgccgaccgtactggtcacgctttattgcacacgctttat
caaagcaacgtgaaaatgggtactcaattcttcgttgagtggatcgctcttgatttgatc
cgtaacgaagcgggtgatgtactcggtgtaactgcaattgaccaagaaactggtaatatt
gcagtattccaagcaaaagcaacattatttgcaactggtggtgctggtcgtgtttaccgt
gcatcaacaaatgcttatatcaacactggtgatggtcttggtatggctgctcgtgctggt
attccattacaagatatggaattctggcaattccaccctacaggtgttgcgggcgcaggc
gtattgttgactgaaggttgtcgtggtgaaggtgcgatccttcgtaacaaagacggcgaa
ccattcatggaacgttatgcaccaactttaaaagacttggctccgcgtgacttcgtatca
cgttctatggaccaagaaattaaagaaggtcgtggttgtggtccaaaaggtgattatatc
ttgcttgatatgactcacttgggtgctgacacaattatgaagcgtttaccatctgtattt
gagattggtaaaaaattcgcaaacgttgacatcactaaagaaccaattccagtagtacca
acaatccattatcaaatgggtggtattcctacgaatatgcatggtcaagtgtgcttacca
gagcctggtacagacaactacactaaacctgtaaaaggtttctatgcaatcggtgagtgt
tcatgcgtatcagtacatggtgcgaaccgtttaggtacgaactcacttcttgacttggtt
gtatttggtaaggctgctggtgagcacattatcgattacgtaactaagcatcatggtgat
gaatatgcaccgcttccaacaaatgtattagagcaaactttagctcgtgtacgtaaattg
gatgaatcaacttctggcgaaaatgctcaagaagttgctgatgcaattcgtgatatcgtt
caagaccacgcaggtgtattccgtactcaagcattgcttgataaaggtgttaaagagatt
cttgctctcgaaccacgcgtgcgtaacatccacttgaaagataaatctaaagtatttaac
actgcacgtgttgaagcgcttgaagttgaaaacttatatgaagttgcaaaagctacatta
atttcagctgctgcgcgtaaagaatgtcgtggtgcgcatacggtagttgattatgaatta
ccagctgatcacccaacttattcatacggtcgccgtgatgatgagtggatgaaacatact
ttatggtattcatcagataaccgtttggaatataagccagtgcgcttcaagccgttaact
gttgatccaattccaccagcaccacgtacattctaa

DBGET integrated database retrieval system