KEGG   Acinetobacter baumannii AYE: ABAYE0777Help
Entry
ABAYE0777         CDS       T00667                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase, iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
aby  Acinetobacter baumannii AYE
Pathway
aby00020  Citrate cycle (TCA cycle)
aby00190  Oxidative phosphorylation
aby00650  Butanoate metabolism
aby01100  Metabolic pathways
aby01110  Biosynthesis of secondary metabolites
aby01120  Microbial metabolism in diverse environments
aby01130  Biosynthesis of antibiotics
aby01200  Carbon metabolism
Module
aby_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aby_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
aby_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:aby00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABAYE0777 (sdhB)
   00650 Butanoate metabolism
    ABAYE0777 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ABAYE0777 (sdhB)
Enzymes [BR:aby01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ABAYE0777 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     ABAYE0777 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer4_18 Fer4 Fer4_6
Motif
Other DBs
NCBI-ProteinID: CAM85735
UniProt: B0VEH1
LinkDB All DBs
Position
796561..797271
Genome map
AA seq 236 aa AA seqDB search
MSRGTRTFEIYRYDPDKDKAPYMQTFKLELTDKHRMLLDALLALKVQDETLTFRRSCREG
ICGSDGVNINGKNGLACLQNLNDLPEKIVIRPLPGLPVVKDLVVDMNQFYDQYDKIQPFL
INNQPAPPKERLQSPEEREHLNGLYECILCACCSTSCPSFWWNPDKFLGPSALLNAYRFI
IDSRDTATAERLARLDDPFSLFRCKGIMNCVSVCPKGLNPTKAIGHIRNMLLDQAG
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaggtactcgtacattcgaaatctaccgctatgatcctgataaggataaagcg
ccgtacatgcaaactttcaagcttgaattgactgataagcaccgtatgttgcttgatgca
ttgcttgctttgaaggttcaagacgaaacattaacattccgtcgttcttgccgtgaaggt
atttgtggttctgatggtgtgaatatcaatggtaaaaatggtttggcttgcttgcaaaac
cttaacgatttaccagagaaaattgtaattcgtccattacctggtttgccggttgttaaa
gatttggttgttgatatgaaccaattctatgatcagtatgacaaaattcagccattcttg
atcaataaccaacctgctccacctaaagagcgtttgcaatctcctgaagagcgtgaacac
ttaaatggtttgtatgagtgtattctttgtgcatgttgttcaacttcatgcccatcattc
tggtggaaccctgataaattcttgggtccttcagcgttgttgaatgcatatcgttttatt
atcgactctcgtgatactgcaactgcagaacgtttggctcgtcttgacgatccgttcagt
ttgttccgttgtaaaggtattatgaattgtgtgtcagtatgccctaaaggtttgaatcca
acaaaagcaatcggtcatatccgtaatatgttgttagatcaagcgggttaa

DBGET integrated database retrieval system