KEGG   Acinetobacter baumannii AYE: ABAYE1944Help
Entry
ABAYE1944         CDS       T00667                                 

Gene name
budC
Definition
(GenBank) acetoin dehydrogenase (diacetyl reductase)
  KO
K03366  meso-butanediol dehydrogenase / (S,S)-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.- 1.1.1.76 1.1.1.304]
Organism
aby  Acinetobacter baumannii AYE
Pathway
aby00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:aby00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ABAYE1944 (budC)
Enzymes [BR:aby01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.76  (S,S)-butanediol dehydrogenase
     ABAYE1944 (budC)
    1.1.1.304  diacetyl reductase [(S)-acetoin forming]
     ABAYE1944 (budC)
    1.1.1.-  
     ABAYE1944 (budC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Polysacc_synt_2 3HCDH_N Methyltransf_31 Epimerase WcbI Methyltr_RsmB-F Methyltransf_25 Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: CAM86823
UniProt: B0VDZ1
LinkDB All DBs
Position
complement(2000717..2001508)
Genome map
AA seq 263 aa AA seqDB search
MNMVKGLQNKVALVTGAAQGIGRGIALRLAQEGAHIALVDMKQDRLNDVQQEIQALGVNA
STFIADVSDREQVYAAINHAEQTLGGFDVMINNAGIAQVQAIADITPDEFQKIVDINIGG
VLWGIQAAAAKFKQREHKGKIINACSIAGHDGFALLGIYSATKFAVRALTQAAAKEYASH
GITVNGYCPGIVGTDMWVEIDKRFAEITGAAIGETYKKYVEGIALGRAQTPDDVAALVAF
LASEDSNYITGQSILTDGGIVYR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
ttgaacatggttaagggattacaaaataaagtcgctttagtgactggggcagcccaaggc
attggccgtgggattgccctgcgcttggcgcaagaaggagcacatattgcattagttgat
atgaaacaagatcgactgaacgatgtgcagcaggaaattcaggctttaggtgtaaatgcg
agtacatttattgccgatgtaagtgaccgcgagcaagtgtatgctgctataaatcatgct
gagcagacacttggtgggtttgatgtcatgattaataacgctggaattgcacaagttcaa
gcgattgctgatatcacaccagatgaattccaaaaaattgttgatattaatattggtgga
gtgctgtggggaatacaggctgctgcggcaaaatttaaacaacgcgaacataaaggtaaa
atcattaatgcttgctcaattgcaggccacgacgggtttgctttactcggtatttactcg
gcaaccaaatttgcggtacgagcacttacccaagctgcggcaaaagaatatgccagtcac
ggtattacggtaaatggatattgtcccggaattgtcggaactgacatgtgggttgaaatt
gataaacgttttgctgaaattaccggtgccgctataggtgaaacttataaaaaatatgtg
gaaggcattgctttaggtagagcccaaacaccagatgatgtagctgcattagttgctttt
ctggcaagtgaagattcgaactatataacgggtcaatccattttaacggacggcggaatt
gtctatcgctaa

DBGET integrated database retrieval system