KEGG   Acinetobacter baumannii AYE: ABAYE1945Help
Entry
ABAYE1945         CDS       T00667                                 

Gene name
acoD
Definition
(GenBank) dihydrolipoamide dehydrogenase (E3 component of pyruvate and 2-oxoglutarate dehydrogenases complexes)
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
aby  Acinetobacter baumannii AYE
Pathway
aby00010  Glycolysis / Gluconeogenesis
aby00020  Citrate cycle (TCA cycle)
aby00260  Glycine, serine and threonine metabolism
aby00280  Valine, leucine and isoleucine degradation
aby00310  Lysine degradation
aby00380  Tryptophan metabolism
aby00620  Pyruvate metabolism
aby00630  Glyoxylate and dicarboxylate metabolism
aby00640  Propanoate metabolism
aby01100  Metabolic pathways
aby01110  Biosynthesis of secondary metabolites
aby01120  Microbial metabolism in diverse environments
aby01130  Biosynthesis of antibiotics
aby01200  Carbon metabolism
Module
aby_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aby_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
aby_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aby00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABAYE1945 (acoD)
   00020 Citrate cycle (TCA cycle)
    ABAYE1945 (acoD)
   00620 Pyruvate metabolism
    ABAYE1945 (acoD)
   00630 Glyoxylate and dicarboxylate metabolism
    ABAYE1945 (acoD)
   00640 Propanoate metabolism
    ABAYE1945 (acoD)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ABAYE1945 (acoD)
   00280 Valine, leucine and isoleucine degradation
    ABAYE1945 (acoD)
   00310 Lysine degradation
    ABAYE1945 (acoD)
   00380 Tryptophan metabolism
    ABAYE1945 (acoD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aby04147]
    ABAYE1945 (acoD)
Enzymes [BR:aby01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     ABAYE1945 (acoD)
Exosome [BR:aby04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   ABAYE1945 (acoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 GIDA FAD_oxidored FAD_binding_2 NAD_binding_8 HI0933_like 3HCDH_N K_oxygenase 2-Hacid_dh_C XdhC_C FAD_binding_3 DAO AlaDh_PNT_C Thi4 ApbA ATPgrasp_N ThiF Lycopene_cycl NAD_binding_2 NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: CAM86824
UniProt: A0A0R4J8D1
LinkDB All DBs
Position
complement(2001529..2002932)
Genome map
AA seq 467 aa AA seqDB search
MSEAQFDLIVIGAGPGGYVAAIRAAQLGLKTAIVEERHLGGICLNWGCIPTKALLAGAEL
ATQFKHARQFGFQVSQLDFDIQKLVQHSRQVSAQLVQGIDYLLKKNQVTVFNGRAQLTAK
EKLEVTDAQGNSQALSAPHIILATGAKARHVPQLPVDGTYVWSYKEALVPEQLPKSLLVV
GSGAIGSEFASLYQDLGCQVTLIDLAKQILPTEDAEVAQFVRKQFEQKGMKVLTDAVVQS
IQIENEQVHCVVETANDVQTLVFDRVLSAIGVQPNTTGLGLERLGVELNPQGFVAIDDYC
KTNVAGLYAIGDVAGAPCLAHKASHEAIICVEKIAGVANVHSLDRSQIPGCIFTHPQVAS
IGLTENAAKAKNLPIRIGKFSLTANGKALAIGDASGFVKTVVHAETGELLGAHMVGHEVT
EHIQGFVIAKYLEATDESLAQVIFPHPTLSEAMHESILASMQRAIHM
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaagctcaatttgatttaattgtgattggcgcgggaccgggtgggtatgtggct
gcaattcgtgcagcccagctcgggttaaaaaccgcaattgtagaagagcgacatttaggc
ggaatttgtctaaattggggctgtattccaaccaaagctttgcttgcaggggctgagctc
gcaacccagtttaaacatgccagacagtttggttttcaggtatcgcaactcgattttgat
attcaaaagcttgtgcaacatagccgacaagtgtcagctcaattagtacaaggcatcgat
tacttactgaaaaagaatcaggtgacggtttttaatggtcgtgctcagcttacggcaaaa
gaaaaacttgaagtgacagatgctcaaggtaatagtcaggctttgagtgcaccacatatc
attttggcaactggagctaaagctcgacatgttcctcaacttcctgtcgatggaacatat
gtctggagctataaagaagcgcttgttccagagcagttaccgaaaagtttgctggttgta
ggttcaggtgcaattggtagcgagtttgctagcctttatcaagacttgggttgtcaggtg
acattaattgatttagccaagcagattttaccaactgaagatgcggaagttgcccaattt
gtcagaaaacaatttgaacaaaaaggtatgaaagtcttaaccgatgctgtcgttcaaagt
attcaaattgaaaatgagcaagtccactgtgtggttgaaacggcaaatgatgttcaaacg
cttgtttttgatcgcgtgctttcggcaattggtgtacagccgaataccacagggctagga
ctagaacgtttaggtgtagaactcaatccacaaggttttgtggcaattgatgactattgt
aaaaccaacgtagcagggctttatgccattggtgatgttgctggagcaccttgtctcgct
cataaagcaagccatgaagccataatatgcgtcgagaaaatcgctggtgtggcaaacgtc
cattcactcgaccgtagccagatacctggttgtatttttacacatccacaagtggcgagt
attggtttaacggaaaatgcagcaaaagctaagaatctacctatacgtattggtaagttt
tctttaactgcaaatggtaaagctttagcaattggagatgcgtcaggtttcgttaaaacg
gtggtacatgcagaaacaggtgaattacttggtgcacatatggtgggtcatgaagtgacc
gaacatatccaaggatttgtcattgcgaaatatctagaagcaactgatgaaagtttagct
caagtgattttcccgcatccaacattatcagaagccatgcatgaatccattttggcttca
atgcaacgagcgattcatatgtag

DBGET integrated database retrieval system