KEGG   Acinetobacter baumannii AYE: ABAYE2568Help
Entry
ABAYE2568         CDS       T00667                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit, FAD/NAD(P)-binding, detoxification of hydroperoxides
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
aby  Acinetobacter baumannii AYE
Brite
KEGG Orthology (KO) [BR:aby00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ABAYE2568 (ahpF)
Enzymes [BR:aby01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     ABAYE2568 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored DAO FAD_binding_3 Thi4 K_oxygenase AlaDh_PNT_C Cytochrom_C_2 NAD_binding_8 FMO-like Spermine_synth Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: CAM87407
UniProt: B0VAK4
LinkDB All DBs
Position
2601020..2602606
Genome map
AA seq 528 aa AA seqDB search
MHWSKKQMLDQNIKTQLKAYLERLESPIELVAALDESDKAAQIKELVTEIAELSDKVTAR
FDGNNTRRPSFGVAKAGEQPRVFFAGLPMGHEFTSLILALLQVSGYAPKVSDEVLNQIKG
LNLKANFDVFVSLSCHNCPDVVQALNLIAIYNPNTTATMIDGAFFQDEVEQRKIMAVPMV
FQDNEHIGQGRMTLEEIVAKLDTNSAEKDAAALNAKDAFDVLVIGGGPAGATAAIYAARK
GINTGIVAERFGGQVMDTMDIENFTSVQKTQGPKFAAEMEAHVREYDVDIMNLQRVSKIT
GADQTANGLVEVELENGAKLESKTVILSTGARWREMNVPGEAEYRTRGVAYCPHCDGPLF
KGKRVAVIGGGNSGVEAAIDLAGIVEHVTLVEFDTKLRADQVLQNKLNSLPNTTVIMNAL
STEVLGDGSQVTGLKYKDRATDEEHVVELAGIFVQIGLLPNTDFLKDSEVELTNRGEIIV
NDRNETNVKGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYIIRSGQ
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgcattggagtaaaaaacagatgttagatcaaaacattaaaactcaattaaaagcttac
ctagaacgtttagaaagtccaatcgaattagttgctgctttagatgaatcagacaaagct
gctcaaattaaagaattagtaactgaaatcgctgagctttctgacaaggtaacagcccgt
tttgacggtaacaatacacgtcgtccaagctttggtgtggctaaagcaggtgaacaacct
cgtgtgttctttgcaggcttaccaatgggccatgagtttacgtctttgatcctggctctg
ttacaagtgtctggctatgcacctaaagtgtcggatgaagtgcttaaccagattaaaggc
ttaaacctcaaagctaactttgatgtattcgtatcattaagctgtcataactgtccggac
gtggtacaggcgcttaacctgattgccatttataacccgaacaccacggcaaccatgatt
gatggtgcattcttccaagacgaagtggaacaacgcaaaatcatggctgtaccgatggtc
ttccaggacaatgaacacattggtcaaggtcgtatgacccttgaagagattgtggcaaaa
cttgataccaactcagctgaaaaagacgcagcagcactcaatgccaaagatgcgtttgat
gtattggtgattggtggtggacctgcgggtgcaacagctgcaatctatgcggcacgtaaa
ggcattaacacaggtatcgtggctgaacgctttggtggtcaggtcatggacaccatggac
attgaaaacttcacttctgtgcaaaagactcaaggtcctaagtttgctgccgagatggaa
gcacatgttcgtgaatacgatgtcgatatcatgaacctgcaacgtgtcagcaaaatcacg
ggtgcagaccaaacagcaaatggcttggttgaagttgaacttgaaaacggtgcaaaactt
gaatcgaaaactgtgatcctttcaacaggggcacgttggagagaaatgaatgtaccgggt
gaagctgaataccgtacccgtggtgtagcgtactgtccacactgtgatggtccattgttc
aaaggcaaacgtgttgccgtgattggtggcggtaactcaggtgttgaagcggcgattgac
cttgcaggtattgttgagcatgtaactctggttgagttcgacactaaacttcgtgctgac
caagtcttgcaaaacaagttaaacagcttgccaaacaccactgtgattatgaatgcatta
agcacagaagtattgggtgacggttcacaagtaaccggtcttaaatataaagaccgtgcg
actgatgaagagcatgtggtagagcttgcagggatctttgtacagattggtttacttcca
aacactgacttcttaaaagatagtgaagttgagctaaccaaccgtggagagatcattgtg
aatgaccgcaacgaaaccaatgtaaaaggtgtatttgctgcaggtgactgtaccactgta
ccgtacaagcaaatcattattgctacaggtgaaggcgctaaagcatcactctctgcgttt
gattacatcattcgttctgggcagtaa

DBGET integrated database retrieval system