KEGG   Acinetobacter baumannii MDR-ZJ06: ABZJ_02912Help
Entry
ABZJ_02912        CDS       T01820                                 

Definition
(GenBank) acyl-CoA desaturase
  KO
K00508  linoleoyl-CoA desaturase [EC:1.14.19.3]
Organism
abz  Acinetobacter baumannii MDR-ZJ06
Pathway
abz00591  Linoleic acid metabolism
abz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00591 Linoleic acid metabolism
    ABZJ_02912
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:abz01004]
    ABZJ_02912
Enzymes [BR:abz01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.3  acyl-CoA 6-desaturase
     ABZJ_02912
Lipid biosynthesis proteins [BR:abz01004]
 Desaturase
  Front-end
   ABZJ_02912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-ProteinID: AEP07372
LinkDB All DBs
Position
complement(209624..210718)
Genome map
AA seq 364 aa AA seqDB search
MNMPVKVEYFKNPKNRDLTPAELEAFAKELDQIKQEVLDDLGEKDAKYIRRVYAAIRYSS
FLGRACLFAGWFPPAWILGTGLLGFSKIMENMELGHNVMHGQYDWMNDPKFNGQTYEWDT
VGTSDNWRQTHNYKHHTYTNIKGIDDDIGYGLLRLFPEQRWKPGFLLQPIYSIPFCLLFQ
WGVAIQNLEIGRVLYKRKTKAQFLEELKPVNKKIGKQLFKDYVFFPLIAGPAALPVFTGN
LVANGLRNIWTFSIIFCGHFTKDAEVFPKSVLQEESRGHWYMRQIRGSSNLTGSEAFHIL
SGHLSHQIEHHLFPDIPARRYRQMAPKVEAVCKKYGLNYNNASFVKQFGQVVGRIVKYAF
PFKK
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgccagtgaaagtcgaatattttaaaaatcctaaaaatcgagatttgactcca
gcagaacttgaagcatttgcaaaagagcttgatcagatcaaacaagaagtattggatgat
ttgggtgaaaaagacgctaaatatatccgccgtgtctatgctgctattcgttatagtagc
tttttaggccgagcttgtttatttgcaggttggttcccgccagcgtggattttaggtaca
ggtttattaggtttctctaaaattatggagaacatggagctcggccataatgttatgcac
ggtcaatatgactggatgaatgacccgaaatttaatggtcaaacttatgaatgggatact
gtaggtacctctgacaactggcgtcaaacccacaactataaacatcatacttataccaat
attaaaggtattgatgatgacattggttatggcttacttcgcttattccctgaacaacgt
tggaagccagggttcttattgcagcctatttacagtattccattttgcttattgttccag
tggggcgtagcaattcagaatcttgaaattgggcgtgtactttacaagcgtaaaactaag
gcacaatttttagaagagttaaaaccggttaataaaaagattggcaagcaactctttaaa
gattatgttttcttcccacttattgcagggccggcagcactaccagtatttacaggtaac
ttggtcgcaaatggccttcgtaatatctggacctttagtattattttctgtggtcatttc
acgaaagatgcagaagtgtttccaaaatctgttttacaagaagaaagccgtggacactgg
tatatgcgccaaattcgtggttcttctaacttaacaggttcagaagcattccatattttg
tctggtcacttaagtcatcaaattgaacatcacttattcccagatattcctgctcgtcgt
tatcgtcaaatggctccaaaagttgaggcggtttgtaagaaatatggcttgaactataac
aatgcaagctttgttaagcagtttggacaagtggttgggcgtattgtgaaatatgcgttc
ccatttaaaaaataa

DBGET integrated database retrieval system