KEGG   Acinetobacter baumannii MDR-ZJ06: ABZJ_02935Help
Entry
ABZJ_02935        CDS       T01820                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
abz  Acinetobacter baumannii MDR-ZJ06
Pathway
abz00020  Citrate cycle (TCA cycle)
abz00480  Glutathione metabolism
abz01100  Metabolic pathways
abz01110  Biosynthesis of secondary metabolites
abz01120  Microbial metabolism in diverse environments
abz01130  Biosynthesis of antibiotics
abz01200  Carbon metabolism
abz01210  2-Oxocarboxylic acid metabolism
abz01230  Biosynthesis of amino acids
Module
abz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abz_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:abz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABZJ_02935
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ABZJ_02935
Enzymes [BR:abz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     ABZJ_02935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH UBM
Motif
Other DBs
NCBI-ProteinID: AEP07395
UniProt: G2JK91
LinkDB All DBs
Position
complement(235001..237238)
Genome map
AA seq 745 aa AA seqDB search
MAGEKSTIIYTLTDEAPLLATYSLLPIIETFTKPAGIEIVKSDISVAARVLAEFADYLSE
EQKVSDNLAELGRLTQDPDTNIIKLPNISASVAQLTACIKELQSKGYAIPDYPENPATEE
EKTIKARYGKCLGSAVNPVLREGNSDRRAPAAVKNYAKKHPHSMSEWKQWSQTHVSHMEE
GDFYHGEKSMTLDRPRNVKMELITNSGKSIVLKPKVALQEGEIIDSMFMSKKALCDFYEK
QLDDCREAGILFSLHVKATMMKVSHPIVFGHCVKIYYKEAFEKHGKLFDELGINVNNGMA
GLYEKIETLPTSLREEIIEDLHACQEHRPALAMVDSAKGITNFHSPNDIIVDASMPAMIR
AGGKMWGADGKQYDAKAVMPESTFARIYQEMINFCKWHGNFDPKTMGTVPNVGLMAQKAE
EYGSHDKTFEIPEAGIANITDLDTGEVLLTQNVEEGDIWRMCQVKDAPIRDWVKLAVTRA
RNSGMPAIFWLDPYRPHENELIKKVQKYLKDHDTTGLDIQIMSQVRAMRYTLERVVRGLD
TISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVQQLVEEN
HLRWDSLGEFLALAVSLEEMGIKENNARAKLLAKTLDEATGKLLDNDKSPSRRTGELDNR
GSHFYLSLYWAEALAAQNEDAELKAKFAPLAKALAENEQKIVAELAQVQGKPADIGGYYA
VDPAKVSAVMRPSATFNAALSTVQA
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atggctggtgaaaagtcaaccatcatttacacactgactgacgaggcgccattattggcg
acttattcgctactgccgatcattgagacctttactaagccagctggtatcgagattgtt
aaaagtgacatctctgtagctgcacgtgtgctcgcagaattcgctgactacctaagtgaa
gagcaaaaggtatccgacaaccttgctgagctaggtcgtcttacacaagatccagatact
aacattatcaaactcccaaatattagtgcctctgttgcgcaattgacagcatgtattaaa
gaacttcaatctaaaggttatgcaattcctgactatccggaaaacccagcgactgaagaa
gaaaaaacaatcaaagctcgttatggcaaatgcctaggttcagcagtaaaccctgttctt
cgtgaaggtaactctgaccgtcgtgctcctgctgccgttaaaaattacgctaagaaacac
cctcactcaatgagcgagtggaaacaatggtcgcaaactcacgtttcacacatggaagaa
ggtgacttctaccacggtgaaaagtcaatgacacttgaccgtccacgcaatgtaaaaatg
gaacttatcacaaacagtggtaagagcattgttcttaagccaaaagttgcgcttcaagaa
ggcgaaatcattgactcaatgttcatgagcaaaaaagcgctttgcgacttctatgagaaa
caacttgatgactgccgtgaagcaggaattttattctcattacacgtaaaagcgacaatg
atgaaagtttcacacccgatcgttttcggtcactgtgtgaaaatctactataaagaagct
ttcgaaaaacacggtaagttgtttgacgaattaggtattaacgtaaataacggtatggct
gggttatacgagaaaatcgaaactcttccaacctcattacgtgaagaaatcattgaagat
ttacatgcttgccaagaacaccgtcctgcacttgcgatggttgactcagcaaaaggtatc
actaacttccattcacctaacgacatcatcgtagatgcttctatgcctgcaatgatccgt
gctggtggtaaaatgtggggtgctgatggtaagcaatacgatgctaaggcagtaatgcca
gaatcaacatttgcccgtatttaccaagaaatgatcaatttctgtaaatggcatggtaac
tttgatccaaaaacaatgggtacagtaccaaacgttggtttgatggctcaaaaagctgaa
gaatacggttctcacgacaagacttttgaaattcctgaagcaggtattgcaaacattact
gatcttgacactggtgaagtgttattgactcaaaatgttgaagaaggcgatatctggcgt
atgtgtcaggtgaaagacgctccgattcgtgactgggtaaaacttgcagtaactcgtgca
cgtaactcaggcatgcctgcgatcttctggcttgacccatatcgtccacacgaaaatgaa
ttgatcaagaaagtacagaagtacttaaaagatcacgatacgactggtcttgatatccag
atcatgtctcaagtacgtgcaatgcgttacacacttgagcgtgtagttcgtggcctcgat
acaatttctgtaaccggtaacatcttacgcgactacttaactgacttgttcccaattatg
gaacttggtacttctgcgaaaatgttgtctatcgttccgcttatggcgggtggtggcatg
tacgaaactggtgcgggtggttcagcacctaaacacgtacaacaacttgttgaagaaaac
cacttacgttgggattcgcttggtgagttccttgcgcttgcagtttctctagaagaaatg
ggtattaaagaaaataatgctcgtgcgaagttacttgcgaagacacttgatgaagcgact
ggtaaattgcttgacaatgacaagtctccatcacgtcgtacaggcgaacttgacaaccgt
ggcagtcacttctacttgtcactttactgggcagaagcacttgctgcacagaacgaagat
gctgagttgaaagctaaatttgctccacttgcaaaagcattagctgaaaacgaacagaag
atcgttgctgagcttgctcaagtacaaggtaaaccagctgatatcggtggttactatgca
gttgacccagcgaaagtaagcgctgtaatgcgtccaagtgctacatttaatgcagcgctt
tcaactgttcaggcttaa

DBGET integrated database retrieval system