KEGG   Acidobacterium capsulatum: ACP_0816Help
Entry
ACP_0816          CDS       T00868                                 

Definition
(GenBank) oxidoreductase, zinc-binding dehydrogenase family
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
aca  Acidobacterium capsulatum
Pathway
aca00040  Pentose and glucuronate interconversions
aca00051  Fructose and mannose metabolism
aca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ACP_0816
   00051 Fructose and mannose metabolism
    ACP_0816
Enzymes [BR:aca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     ACP_0816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc 2-Hacid_dh_C Pyr_redox_2 F420_oxidored NAD_binding_2 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ACO33338
UniProt: C1F2R7
LinkDB All DBs
Position
complement(934575..935696)
Genome map
AA seq 373 aa AA seqDB search
MATTLPRQDVAGGAAPISATMRAAVYRGVNDVRVESVPVPQVAAGEVLIRVHSCGICGTD
LKKIHTGSHSAPRIFGHETSGTIVAVGEGVEGFAVGDRVMVFHHIPCGECYYCRKRTFAQ
CPVYKKVGCTAGFEPSGGGFAEYVRVMDWIVKRGLVKIPDGVPFEQAAFVEPVNTCLKAI
KNLDLAADETVLVIGQGPIGIILAALAARSGAKVLTSDLYAERHATAAKFGLKHPIDAGK
QDVVAAAHAASDGRGADAVILAVGGNALIKTAMDAARPGGRVLLFAQTQHGDAVIDPAAV
CMDEKSLVGSYSASVEIQDEGAQVVFDGYRNGFDLTQLISHRFGLEQAVEAIEVASHPSA
GSMKIFIQPGEQA
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggctacgactctccccaggcaggatgtcgcaggtggggctgcgccgatctccgcgacc
atgcgcgccgcggtctatcgcggagtaaatgacgtgcgcgtggaaagtgttcctgtgccg
caggttgcggccggggaggtgctgatccgggtacactcgtgcggcatctgcggcactgat
ctcaagaagattcatacgggctcgcactccgcgccgcgcatttttgggcatgagaccagc
ggcacaattgtggccgtgggcgagggtgtcgaaggctttgccgtgggcgaccgcgtgatg
gtctttcatcacattccttgcggggagtgctactactgccgcaaaaggacctttgcgcag
tgcccggtctataaaaaggtgggttgcacggcgggctttgagccttcgggcggcggcttt
gccgagtatgtgcgcgtgatggactggattgtgaagcgcggcctggtgaagattcccgac
ggcgtgccgtttgagcaggccgcatttgtggagccggtgaatacctgcctgaaggccatc
aagaatcttgacctggcggcggatgaaaccgtgctggtgatagggcaggggccaatcggg
attattctggcggcgctggcggcgcgctcgggcgcgaaggtgctgacctctgatctctat
gccgagcggcatgcgacggcggcaaagtttggcctcaagcatccgattgatgcgggcaag
caggatgtggtggcggcagcgcatgcggccagcgacgggcgcggcgcggatgccgtgatt
ctggcggtgggcggcaatgcgctcatcaagacggcgatggatgcggcgcggcccggcggg
cgggtgctgctctttgcgcagacgcagcatggagatgcggtgatcgatccggcggcggtg
tgcatggatgagaagtcgctggtgggctcgtacagcgcctcggtggagattcaggacgag
ggcgcgcaggtggtctttgacggctaccgcaacgggtttgatttgacgcaactgatttcg
catcgcttcgggctggagcaggcggtggaggcaatcgaggtggcttcgcatcctagcgcg
gggtcaatgaagattttcattcaaccgggcgagcaggcatga

DBGET integrated database retrieval system