KEGG   Acidobacterium capsulatum: ACP_0838Help
Entry
ACP_0838          CDS       T00868                                 

Definition
(GenBank) oxidoreductase, FAD-dependent
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
aca  Acidobacterium capsulatum
Pathway
aca00564  Glycerophospholipid metabolism
aca01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aca00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ACP_0838
Enzymes [BR:aca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     ACP_0838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored NAD_binding_8 HI0933_like Pyr_redox_2 GIDA Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ACO33618
UniProt: C1F2T9
LinkDB All DBs
Position
961001..962638
Genome map
AA seq 545 aa AA seqDB search
MEQPVNREQMLARIQAHPEPWDMIIIGGGATGAGVAVDAASRGFDVLLLEAVDFGKGTSS
RSTKLVHGGVRYLEQGNVSLVMSALKERGLLRQNAPHLVSDLAFIVPNYAWWQTPFYGAG
LKVYDLLAGRYGFGKSRILSEQETIERLPNIERHELRGGVVYYDGQFDDARLLIDLIATA
ADHGATLLNYMPVIAINKSAAASQPDELIRGVTARDSESGETFDLEARVVVNATGIFTDE
VRHMADPDADKMIAPSQGIHLVFDKSFLRGDSALMVPRTSDGRVLFAIPWHNHTVVGTTD
TPIPEPLYEPRPLEEEIEFILETAAQYLSRPPKRSDVLSVYVGVRPLVKSEHAGSKTSSL
SRDHVIHIDNYGLLTITGGKWTTYRHMAEDCVDHAITLGPLEDRPCQTRNLRIHGYCEDT
RGLGHLYVYGAEADNIRAIAEAEPHLAAPLHPQLPYTGAEVAWAVRHEMARTVEDVLARR
TRALFLNAHAAIEMARPVATLMAAELRLPANHAQSWIDAQTSAFVELAKQYTLSATQSTV
ITEKP
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggaacaacctgtgaaccgcgaacagatgctggcgcgcatccaagcgcatcctgaaccc
tgggacatgatcatcatcggcggcggagccaccggggccggtgtcgccgtcgatgccgca
tcgcgcggctttgacgtgctgctgctcgaggccgtggacttcggcaagggcacctccagc
cgcagcaccaagctcgtgcatggcggcgtgcgctatctggagcagggcaacgtctcgctt
gtcatgtcggccctcaaagagcgcggactgttgcgccagaatgcgccgcacctggtgagc
gacctagccttcatcgtgcccaactacgcctggtggcaaacgcccttctacggcgcgggc
ctcaaggtctatgacctgctcgccggccggtacggcttcggcaagtcgcgcattctgtca
gagcaagagaccatcgagcggctgcccaacatcgagcgccatgagctgcgcggcggcgtg
gtttattacgatggccagttcgatgacgcgcgcctgcttatcgacctcatcgccacggcg
gccgaccacggcgcaacgctcctcaactacatgcccgtcatcgccatcaacaagagtgcg
gccgcctctcagccagacgaactcattcgcggcgtcaccgcgcgcgacagcgaatccggc
gagacctttgatcttgaagcccgcgtcgtcgtcaacgccaccggcatcttcaccgacgaa
gtgcgccacatggccgaccccgatgccgacaaaatgatcgcgcccagccagggcattcat
ctcgtctttgacaaatcctttctgcgcggcgacagcgccctcatggtgccgcgcaccagc
gatggccgcgtgctcttcgccattccctggcacaaccacaccgtcgtcggcaccaccgac
acgcccattcccgagccgctctatgagccgcgcccgcttgaggaagagatcgagttcatt
ctcgagaccgccgcgcaatatctcagccgcccgcccaagcgcagcgatgtgctcagcgtc
tacgtgggcgtgcgcccgctcgtgaagtcagagcatgccggcagcaaaacctcttcgctc
tcgcgcgatcacgtcatccacatcgacaactacggcctgctcaccatcaccggcggcaaa
tggaccacctaccgtcacatggccgaggattgcgtcgatcacgctatcacgctcggcccg
ctcgaagaccgcccctgccagacgcgcaacctgcgcattcacggctattgcgaagacacc
cgcggactcggccatctctacgtctacggcgcggaggctgacaacattcgcgccatcgcc
gaagccgagccgcatctggccgcgcctctgcatccgcaactgccctacaccggcgctgaa
gtcgcatgggccgtgcgccacgagatggcccgcaccgtcgaggacgtgctcgcccgccgc
acacgcgcgctctttctcaacgcgcacgccgccatcgagatggcgcgccccgtcgccacg
ctcatggccgccgaactgcgcctgcccgcgaaccacgctcaaagctggatcgacgcgcag
accagcgccttcgtcgaactcgcaaagcaatacaccctctctgcaacgcaatccaccgtc
atcacggagaagccataa

DBGET integrated database retrieval system