KEGG   Acidobacterium capsulatum: ACP_0842Help
Entry
ACP_0842          CDS       T00868                                 

Definition
(GenBank) trehalose synthase/probable maltokinase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
aca  Acidobacterium capsulatum
Pathway
aca00500  Starch and sucrose metabolism
aca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ACP_0842
Enzymes [BR:aca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     ACP_0842
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     ACP_0842
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C APH DUF3459 Cellulase Cyc-maltodext_C
Motif
Other DBs
NCBI-ProteinID: ACO31740
UniProt: C1F2U3
LinkDB All DBs
Position
complement(965454..968765)
Genome map
AA seq 1103 aa AA seqDB search
MFVRKPGSASDPLWYKDALIYELHVRAFYDSNNDGIGDFPGLIEKLDYLQDLGVTCLWLL
PFFPSPLRDDGYDISDYTSVNPSYGTIEDFQRFLNAAHERGLQVMIELVINHTSDQHPWF
QRARQAPAGSPERDFYVWSDSDQKYKDARIIFTDTEKSNWTWDPVAQQYYWHRFFSHQPD
LNFDNPAVLEEVIRVMRFWLDMGVDGLRLDAIPYLIERDGTNCENLSETHALIKAIRKAM
DDGYLGRMILAEANQWPEDVRPYFGDGDECHMAFHFPLMPRIYMALRQEDRLPITDIIAQ
TPAIPESCQWGIFLRNHDELTLEMVSEDERDYMYLAYSADPRMRINIGIRRRLAPLLDNN
RRRIELLNSLLFSFPGTPILYYGDEIGMGDNIYLGDRNGVRTPMQWTGDRNAGFSRATPA
KLFSPVIMDPVWGYEAINVEAQQSDASSLLNWMRNMIALRKLFQVFGRGSMKFLEPENRK
VLAYVREYDGERVLCVANLSRFAQPVALDLSEYAGMIPVEMLGYVEFPAIGKQAYPLTLG
PYGFLWLELQAGEEPVEVPSPGATDELLHVKNETDWPGVLEGRGRETLERLLPEYVQRQR
WFGGKSRPIETVKVTDWSLLDGGHLALVWVDVHYTEGEPDTYLAPMAMAFGEECEAVVEH
HGQAVLTKIFSTRGAGVLYDGMMRDESAQALLRLMAQGGEAAAQHGTVRGTASSLFAELR
GGEAALPVRRGSAEQSNTSVIFGDRLILKLFRRQQTGLNPDMEIGRFLTERTEFRNIAPF
AGALEFVSRDGGEDSTLAMLQGLVQNEGDGWSWMLEELDRYFESAVAASFPEVKLPGTGA
LREKLNGIPAAAREHAGLSIEGASTLGRRTAEMHLSLAVDRRDVDFAPVRMEPDDLAALR
AALQADAARAFDALKANLARLPDDAVETAGLVLSRRTHLLERFQRLTALQDAGAKTRVHG
DYHLGQVLRAKGDFVILDFEGEPARMLQERRTKQSPLKDVAGMVRSFSYAAFSAMTHFSS
RRPADTERLEPWARLWETAVTAEFLRAYRKTMGKSTIVPRTAEAFDVLLQIFTLDKALYE
LVYELNHRPGWVRAPLNGILYLP
NT seq 3312 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgtgcggaagccgggatcggcttctgatccgctctggtataaggacgcgctgatt
tatgagctgcacgtgcgcgctttttacgacagcaacaacgatgggattggagattttccg
gggctgattgagaagctggattatctgcaggacctgggcgtgacgtgcctgtggctgctg
ccgttttttccttcgccgctcagggatgatggctacgacatctctgactacacgagcgta
aacccgagctacgggacgattgaggactttcagcgctttttgaatgcagcccatgagcgc
ggactgcaggtgatgattgagctggtcatcaatcacacgtccgaccagcatccgtggttt
cagcgcgcgcggcaggctccggcaggctcgccggagcgcgacttttatgtgtggagcgac
tcggaccagaagtacaaggacgcgcgcatcatcttcaccgacacggagaagtcgaactgg
acgtgggacccggtggcgcagcagtactactggcaccgcttcttttcgcatcagccggat
ttgaattttgataatcccgcggtgctggaggaagtgattcgcgtgatgcgcttctggctc
gacatgggcgtggatgggctgcggctcgacgccattccttacctgatcgagcgcgacggc
accaactgcgagaatctgtcggagacgcatgcgctgatcaaggcgattcgcaaggcgatg
gatgacggctacctgggccgcatgattcttgccgaagcgaaccagtggcccgaggatgtg
cggccgtattttggcgatggcgatgagtgccacatggcgtttcattttccgctaatgccg
cgcatctacatggcgctgcggcaggaagaccgcctgccgatcaccgacatcatcgcgcag
acgccggcgattcctgagagctgccagtggggcatttttttgcgcaatcacgatgagctg
acgcttgagatggtcagcgaggatgagcgcgactacatgtacctggcgtatagcgccgat
cctcgcatgcgcatcaacattggcatccggcgcaggctggctccgctgctcgataacaac
cgccgtcgcatcgagttgctgaacagtctgctgttttcgtttccgggcacgccgattttg
tactacggcgatgagatcggcatgggcgacaacatctacctgggcgaccgcaacggcgtg
cgcacgccgatgcagtggacgggcgaccgcaatgcgggattttctcgcgcgacgcctgcg
aagctcttcagcccggtgatcatggacccggtgtggggctatgaggccatcaatgtggag
gcgcagcagagcgatgcgtcgtcactgctgaactggatgcgcaacatgattgcgctgcgc
aagctgttccaggttttcgggcgcggctcgatgaagtttctggagccggagaaccggaag
gtgctggcctatgtgcgcgagtatgacggcgagcgcgtgctgtgcgtggcgaacctgtcg
cgctttgcgcagccggtggcgctggatttgtcagagtatgccggcatgattccggtggag
atgctggggtatgtggagtttccggcgatcgggaagcaggcgtatccgctgacgctgggg
ccgtatggatttttgtggctggagctgcaggcgggcgaagagccggtggaggttccgtca
ccgggggcgaccgacgagctgctgcatgtgaagaacgagacggactggccgggcgtgctg
gaaggccgcggccgcgagacgctggagcggctgctgccggagtatgtgcagcggcagcgc
tggtttggcggcaagtcccggccaattgaaactgtgaaagtgacagattggtcgctgctg
gatggcgggcacctggcactggtgtgggtggatgtgcattacaccgaaggagagccggac
acttatcttgcgccgatggcgatggcctttggcgaggagtgcgaagcggtggtggagcac
cacgggcaggcggtgctgacgaagatcttctctacgcgcggcgcgggcgtgctctatgac
ggcatgatgcgcgatgagagcgcgcaggcgctgctgcggctgatggcgcagggcggagaa
gcggcggcacagcatggcaccgtgcgcggcacggcgagcagcctgtttgcggagctgcgc
ggcggcgaggctgcgctgccggtgcggcgcgggtccgccgagcagagcaatacgtcggtg
atctttggcgatcggctgattctgaagctcttccggcggcagcagacggggctgaatcct
gacatggagattggccgctttttgacggagcggacagagtttcgcaacatcgctccgttt
gcgggcgcgctggagtttgtctcgcgtgatgggggtgaggattcgacgctcgcgatgctg
caggggctggtgcagaacgagggcgacggctggtcgtggatgctcgaagaactggaccgc
tactttgagagcgcggtggcggcatcgttccccgaggtgaagctgccgggcacgggcgcg
ctgcgcgagaagctgaacgggattccggcagcggcgcgtgagcatgcgggactttcgatt
gaaggagcttcgacgctgggccggcgcacggcagagatgcacctgtcgctggcggtggac
cgtcgcgatgtggactttgcgccggtgcggatggagcccgatgatctggccgcgctgcgg
gcggcgctgcaggccgatgcggcgcgcgcctttgacgcgctgaaggcgaacctggcgcgg
ctgcccgatgacgccgtggagacggccgggctggtgctgagccgccgcacgcacttgctg
gagcgctttcagcggctcacggcgctgcaggatgcgggcgcgaagacgcgcgtgcatggg
gactatcatctgggccaggtgctgcgcgcgaagggcgactttgtgattctggactttgag
ggcgagccggcgcgcatgctccaggagcggcgcacgaagcagtctccgctgaaggatgtg
gcggggatggtgcgctcgttcagctatgcggcgttttcggcgatgacgcacttttcttcc
cgccgaccggcagacaccgagcggctggagccgtgggcgcggctgtgggagacggcggtg
acggcggagtttttgcgcgcctaccgcaagaccatgggcaagtcgacgattgtgccgcgc
acggccgaggcgtttgatgtgctgctgcagatttttacgctcgacaaggcgctgtatgaa
ctggtgtatgagttgaatcatcgccccggatgggtgcgtgcgccgttgaacggaattttg
tatcttccatag

DBGET integrated database retrieval system