KEGG   Acidobacterium capsulatum: ACP_1251Help
Entry
ACP_1251          CDS       T00868                                 

Definition
(GenBank) non-specific serine/threonine protein kinase
  KO
K08884  serine/threonine protein kinase, bacterial [EC:2.7.11.1]
Organism
aca  Acidobacterium capsulatum
Brite
KEGG Orthology (KO) [BR:aca00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aca01001]
    ACP_1251
Enzymes [BR:aca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     ACP_1251
Protein kinases [BR:aca01001]
 Serine/threonine kinases: Other
  Bacterial family
   ACP_1251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH RIO1 Kdo Haspin_kinase Seadorna_VP7 Pkinase_fungal Choline_kinase ABC1 FTA2 PIP49_C
Motif
Other DBs
NCBI-ProteinID: ACO33785
UniProt: C1F4X6
LinkDB All DBs
Position
complement(1470187..1471164)
Genome map
AA seq 325 aa AA seqDB search
MMLPAEVEVGAQLDHYRIDAKVAETAMATIYRATDERDGRQVAIKVPHASIEADPILFDR
FKREEEIGESMHHVNVMQIVPHHDHSRPYMVMEWVPGKLLRTLLNEEHAFSQERAIRITL
GILRALEYIHNHGVVHRDLKPENIMVDEHDHIKLIDFGIASLEGAKRLTYTGYTQALGTP
EYISPEQVKGKRGDARSDLYALGIMLYEMLTGKTPFTGPSPLAVMNERLMRHPLPPREAN
PQITPHLQEVLYRALERDPRNRYPNAHAFAWDLENLDKVGVADRSELREWKTQRSGSWRK
VLVYVALAAIPIALFVAMLLLSQRH
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgatgcttcctgctgaagtcgaagtcggcgcgcagcttgaccactaccgcatcgacgcc
aaggtagccgagacggccatggccaccatctaccgcgccactgacgagcgcgacggccgc
caggtcgccatcaaggtgccgcacgcctccatcgaggctgaccccattctctttgaccgc
ttcaagcgcgaagaagagatcggcgaaagcatgcaccacgtcaacgtcatgcagatcgtg
ccgcatcatgaccactcccgcccctacatggtcatggagtgggtgcccggcaagctgctc
cgcacgctgctcaatgaagagcatgccttctcgcaggagcgcgccatccgcatcaccctc
ggcattctgcgcgcgctcgaatacattcacaatcacggcgtcgtacaccgcgacctcaag
ccggaaaacatcatggttgacgagcacgaccacatcaagctcattgactttggcatcgcc
tcgctcgaaggcgccaaacgcctcacctacaccggttacacacaggcgctcggcacgccc
gaatacatttcgcccgagcaggtgaagggcaagcgcggcgatgcgcggtctgatctgtat
gcgctcggcatcatgctctacgaaatgctcaccggcaaaacgcccttcaccggcccatcg
cccctggccgtgatgaatgagcgcctcatgcgccaccctttgccgccgcgcgaggccaac
ccgcagatcacgcctcacctgcaagaggtgctttaccgcgccctcgagcgtgacccgcgc
aaccgctaccccaacgcgcacgccttcgcctgggatcttgaaaatctcgacaaggttggc
gtggccgatcgcagcgagttgcgcgagtggaagacccagcgctccggctcctggcgcaag
gtgctggtctacgtggcgctggccgccattcccattgcgctcttcgtggccatgctgctg
ttgtcgcagcgccattga

DBGET integrated database retrieval system