KEGG   Acidobacterium capsulatum: ACP_2273Help
Entry
ACP_2273          CDS       T00868                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase, Mn
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
aca  Acidobacterium capsulatum
Brite
Enzymes [BR:aca01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ACP_2273 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACO34408
UniProt: C1FA78
LinkDB All DBs
Position
complement(2640339..2640950)
Genome map
AA seq 203 aa AA seqDB search
MAHELPPLPYDYSALEPHIDAETMKLHHDKHHQAYINNLNAALEKHPDLASKSAEDLLRD
LNSVPEDIRTAVRNNGGGHVNHTMFWKIMKPNGGGAPTGAIAQQIEKDFGTFEDFKTAFN
GTAAKQFGSGWGWLIWDGGKLKIISTPNQDSPLSQGFFPILGNDVWEHAYYLKYQNKRPD
YLAAWWNTVNWDEVNHRFEHAKK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
ttggcacacgaactgccccctctgccctacgactattcggctcttgaacctcatatcgac
gccgaaaccatgaagctgcaccatgacaagcaccatcaggcctacatcaacaacctgaat
gcggcgctggagaagcatcctgacctggccagcaaatcggccgaagacctgctgcgtgat
ctcaacagcgtgcccgaggacattcgcacggcggtgcgcaacaatggcggcggccatgtg
aaccacaccatgttctggaagatcatgaagcccaacggcggcggcgcgccgaccggcgcc
atcgcccagcagatcgagaaggacttcggcacctttgaggacttcaagacggccttcaac
ggcacggcggccaagcagttcggctccggctggggctggctgatctgggatggcggcaag
ctcaagatcatctccactcccaaccaggacagcccgctgtcgcagggcttctttcccatt
ctcggcaacgatgtgtgggagcacgcctactacctgaagtatcagaacaagcggcccgac
tacctggccgcctggtggaacacggtcaattgggacgaagtgaaccatcgcttcgaacac
gcgaagaagtag

DBGET integrated database retrieval system